Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (CSF1 CSF1 in human placenta was detected using HRP/AEC red color stain.Working dilution: 10 ug/mL.)

Rabbit CSF1 Polyclonal Antibody | anti-CSF1 antibody

CSF1 antibody - middle region

Gene Names
CSF1; MCSF; CSF-1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
CSF1; Polyclonal Antibody; CSF1 antibody - middle region; anti-CSF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
Sequence Length
554
Applicable Applications for anti-CSF1 antibody
Immunohistochemistry (IHC), Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 83%; Dog: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(CSF1 CSF1 in human placenta was detected using HRP/AEC red color stain.Working dilution: 10 ug/mL.)

Immunofluorescence (IF) (CSF1 CSF1 in human placenta was detected using HRP/AEC red color stain.Working dilution: 10 ug/mL.)
Related Product Information for anti-CSF1 antibody
This is a rabbit polyclonal antibody against CSF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound
Product Categories/Family for anti-CSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
macrophage colony-stimulating factor 1 isoform a
NCBI Official Synonym Full Names
colony stimulating factor 1
NCBI Official Symbol
CSF1
NCBI Official Synonym Symbols
MCSF; CSF-1
NCBI Protein Information
macrophage colony-stimulating factor 1
UniProt Protein Name
Macrophage colony-stimulating factor 1
Protein Family
UniProt Gene Name
CSF1
UniProt Synonym Gene Names
CSF-1; M-CSF; MCSF
UniProt Entry Name
CSF1_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

M-CSF: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers. Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: extracellular space; membrane; perinuclear region of cytoplasm; plasma membrane; integral to membrane; receptor complex

Molecular Function: protein homodimerization activity; growth factor activity; cytokine activity; macrophage colony stimulating factor receptor binding

Biological Process: positive regulation of monocyte differentiation; ossification; macrophage differentiation; positive regulation of osteoclast differentiation; positive regulation of cellular protein metabolic process; reproductive developmental process; positive regulation of odontogenesis of dentine-containing teeth; osteoclast differentiation; positive regulation of multicellular organism growth; odontogenesis; cell proliferation; positive regulation of mononuclear cell proliferation; monocyte activation; homeostasis of number of cells within a tissue; positive regulation of protein kinase activity; positive regulation of cell proliferation; innate immune response; hemopoiesis; positive regulation of Ras protein signal transduction; positive regulation of macrophage differentiation; cell differentiation; positive regulation of cell-matrix adhesion; inflammatory response; regulation of ossification; positive regulation of cell migration

Research Articles on CSF1

Similar Products

Product Notes

The CSF1 csf1 (Catalog #AAA3207323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSF1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSF1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the CSF1 csf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAPVAGLTWE DSEGTEGSSL LPGEQPLHTV DPGSAKQRPP RSTCQSFEPP. It is sometimes possible for the material contained within the vial of "CSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.