Western Blot (WB)
(CSDA rabbit polyclonal antibody. Western Blot analysis of CSDA expression in HeLa.)
Rabbit anti-Human CSDA Polyclonal Antibody | anti-CSDA antibody
CSDA (DBPA, DNA-binding Protein A, Cold Shock Domain-containing Protein A, Single-strand DNA-binding Protein NF-GMB) (Biotin)
Gene Names
YBX3; CSDA; DBPA; CSDA1; ZONAB
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSDA; Polyclonal Antibody; CSDA (DBPA; DNA-binding Protein A; Cold Shock Domain-containing Protein A; Single-strand DNA-binding Protein NF-GMB) (Biotin); anti-CSDA antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CSDA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1791
Applicable Applications for anti-CSDA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CSDA, aa1-372 (AAH15564.1).
Immunogen Sequence
MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CSDA rabbit polyclonal antibody. Western Blot analysis of CSDA expression in HeLa.)
Western Blot (WB)
(CSDA rabbit polyclonal antibody. Western Blot analysis of CSDA expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of CSDA expression in transfected 293T cell line by CSDA polyclonal antibody. Lane 1: CSDA transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CSDA expression in transfected 293T cell line by CSDA polyclonal antibody. Lane 1: CSDA transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CSDA antibody
CSDA binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression (By similarity).
Product Categories/Family for anti-CSDA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens cold shock domain protein A, mRNA
NCBI Official Synonym Full Names
Y-box binding protein 3
NCBI Official Symbol
YBX3
NCBI Official Synonym Symbols
CSDA; DBPA; CSDA1; ZONAB
NCBI Protein Information
Y-box-binding protein 3
Protein Family
Research Articles on CSDA
Similar Products
Product Notes
The CSDA (Catalog #AAA6374821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSDA (DBPA, DNA-binding Protein A, Cold Shock Domain-containing Protein A, Single-strand DNA-binding Protein NF-GMB) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSDA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSDA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSDA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
