Western Blot (WB)
(Sample Type: Human, MouseSample Type: 1. Human Lung Fibroblast cells (40ug)2. Mouse lung cells (40ug) Primary dilution: 1:2000Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1:1000Image Submitted by: Xinlei ChenMcGill University )
Rabbit CRISPLD2 Polyclonal Antibody | anti-CRISPLD2 antibody
CRISPLD2 antibody - N-terminal region
Gene Names
CRISPLD2; LGL1; CRISP11; LCRISP2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRISPLD2; Polyclonal Antibody; CRISPLD2 antibody - N-terminal region; anti-CRISPLD2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
Sequence Length
497
Applicable Applications for anti-CRISPLD2 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRISPLD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Human, MouseSample Type: 1. Human Lung Fibroblast cells (40ug)2. Mouse lung cells (40ug) Primary dilution: 1:2000Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1:1000Image Submitted by: Xinlei ChenMcGill University )
Western Blot (WB)
(Sample Type: Human, MouseSample Type: 1. Human Lung Fibroblast cells (40ug)2. Mouse lung cells (40ug) Primary dilution: 1:2000Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1:1000Image Submitted by: Xinlei ChenMcGill University )
Western Blot (WB)
(CRISPLD2 antibody - N-terminal region validated by WB using human and mouse serum, human fetal lung cell culture at 0.5ug/ml.)
Western Blot (WB)
(CRISPLD2 antibody - N-terminal region validated by WB using human and mouse serum, human fetal lung cell culture at 0.5ug/ml.)
Western Blot (WB)
(WB Suggested Anti-CRISPLD2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-CRISPLD2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-CRISPLD2 antibody
This is a rabbit polyclonal antibody against CRISPLD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CRISPLD2 is a novel NSCLP candidate gene.
Target Description: CRISPLD2 is a novel NSCLP candidate gene.
Product Categories/Family for anti-CRISPLD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
cysteine-rich secretory protein LCCL domain-containing 2
NCBI Official Synonym Full Names
cysteine rich secretory protein LCCL domain containing 2
NCBI Official Symbol
CRISPLD2
NCBI Official Synonym Symbols
LGL1; CRISP11; LCRISP2
NCBI Protein Information
cysteine-rich secretory protein LCCL domain-containing 2
UniProt Protein Name
Cysteine-rich secretory protein LCCL domain-containing 2
Protein Family
UniProt Gene Name
CRISPLD2
UniProt Synonym Gene Names
CRISP11; LCRISP2; CRISP-11
Uniprot Description
Promotes matrix assembly.
Research Articles on CRISPLD2
Similar Products
Product Notes
The CRISPLD2 crispld2 (Catalog #AAA3209744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRISPLD2 antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CRISPLD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRISPLD2 crispld2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSCVLGGVIP LGLLFLVCGS QGYLLPNVTL LEELLSKYQH NESHSRVRRA. It is sometimes possible for the material contained within the vial of "CRISPLD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
