Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CRHR1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCRHR1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)

Rabbit CRHR1 Polyclonal Antibody | anti-CRHR1 antibody

CRHR1 antibody - N-terminal region

Gene Names
CRHR1; CRF1; CRHR; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRF-R-1; CRH-R-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRHR1; Polyclonal Antibody; CRHR1 antibody - N-terminal region; anti-CRHR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFL
Sequence Length
415
Applicable Applications for anti-CRHR1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CRHR1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCRHR1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)

Western Blot (WB) (WB Suggested Anti-CRHR1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCRHR1 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Related Product Information for anti-CRHR1 antibody
This is a rabbit polyclonal antibody against CRHR1. It was validated on Western Blot

Target Description: This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346.
Product Categories/Family for anti-CRHR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
corticotropin-releasing factor receptor 1 isoform 2
NCBI Official Synonym Full Names
corticotropin releasing hormone receptor 1
NCBI Official Symbol
CRHR1
NCBI Official Synonym Symbols
CRF1; CRHR; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRF-R-1; CRH-R-1
NCBI Protein Information
corticotropin-releasing factor receptor 1
UniProt Protein Name
Corticotropin-releasing factor receptor 1
UniProt Gene Name
CRHR1
UniProt Synonym Gene Names
CRFR; CRFR1; CRHR; CRF-R-1; CRF-R1; CRFR-1; CRH-R-1; CRH-R1
UniProt Entry Name
CRFR1_HUMAN

NCBI Description

This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Naturally-occurring readthrough transcription between this gene and upstream GeneID:147081 results in transcripts that encode isoforms that share similarity with the products of this gene. [provided by RefSeq, Aug 2016]

Uniprot Description

CRF-R1: a G-protein coupled receptor that specifically binds corticotropin-releasing hormone, a potent mediator of endocrine, autonomic, behavioral, and immune responses to stress. Four splice-variant isoforms have been described.

Protein type: Membrane protein, integral; GPCR, family 2; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: multivesicular body; cell soma; apical part of cell; integral to plasma membrane; dendrite; integral to membrane; plasma membrane; trans-Golgi network; vesicle; intrinsic to plasma membrane

Molecular Function: protein binding; corticotropin-releasing hormone binding; corticotropin-releasing hormone receptor activity; protein complex binding; G-protein alpha-subunit binding; corticotrophin-releasing factor receptor activity

Biological Process: fear response; hypothalamus development; hormone-mediated signaling; adrenal gland development; adenylate cyclase activation; positive regulation of mast cell degranulation; female pregnancy; behavioral response to ethanol; memory; general adaptation syndrome, behavioral process; elevation of cytosolic calcium ion concentration; behavioral response to pain; epithelial cell differentiation; neuropeptide signaling pathway; behavioral response to cocaine; adrenocorticotropin hormone secretion; response to hypoxia; negative regulation of epinephrine secretion; visual learning; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); immune response; parturition; response to electrical stimulus

Research Articles on CRHR1

Similar Products

Product Notes

The CRHR1 crhr1 (Catalog #AAA3216100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRHR1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRHR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRHR1 crhr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WAARVNYSEC QEILNEEKKS KVHYHVAVII NYLGHCISLV ALLVAFVLFL. It is sometimes possible for the material contained within the vial of "CRHR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.