Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CREBL1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit CREBL1 Polyclonal Antibody | anti-ATF6B antibody

CREBL1 antibody - N-terminal region

Gene Names
ATF6B; G13; CREBL1; CREB-RP
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CREBL1; Polyclonal Antibody; CREBL1 antibody - N-terminal region; anti-ATF6B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPF
Sequence Length
703
Applicable Applications for anti-ATF6B antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CREBL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CREBL1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CREBL1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ATF6B antibody
This is a rabbit polyclonal antibody against CREBL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CREBL1 bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-6 beta isoform a
NCBI Official Synonym Full Names
activating transcription factor 6 beta
NCBI Official Symbol
ATF6B
NCBI Official Synonym Symbols
G13; CREBL1; CREB-RP
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-6 beta
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-6 beta
UniProt Gene Name
ATF6B
UniProt Synonym Gene Names
CREBL1; G13; cAMP-dependent transcription factor ATF-6 beta; ATF6-beta; Creb-rp
UniProt Entry Name
ATF6B_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

ATF6B: Transcriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN(9)CCAC[GA]-3') when NF-Y is bound to ERSE. Belongs to the bZIP family. ATF subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; intracellular; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription, DNA-dependent; unfolded protein response; signal transduction

Research Articles on ATF6B

Similar Products

Product Notes

The ATF6B atf6b (Catalog #AAA3200783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREBL1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CREBL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF6B atf6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIADPTRFFT DNLLSPEDWG LQNSTLYSGL DEVAEEQTQL FRCPEQDVPF. It is sometimes possible for the material contained within the vial of "CREBL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.