Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 polyclonal antibody. Lane 1: CRABP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CRABP2 Polyclonal Antibody | anti-CRABP2 antibody

CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-binding Protein II) APC

Gene Names
CRABP2; RBP6; CRABP-II
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRABP2; Polyclonal Antibody; CRABP2 (CRABP-2; CRABPII; CRABP-II; Cellular Retinoic Acid-Binding Protein 2; Cellular Retinoic Acid-binding Protein II) APC; anti-CRABP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CRABP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CRABP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CRABP2, aa1-138 (NP_001869.1).
Immunogen Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 polyclonal antibody. Lane 1: CRABP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 polyclonal antibody. Lane 1: CRABP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CRABP2 antibody
A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
Product Categories/Family for anti-CRABP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,693 Da
NCBI Official Full Name
cellular retinoic acid-binding protein 2
NCBI Official Synonym Full Names
cellular retinoic acid binding protein 2
NCBI Official Symbol
CRABP2
NCBI Official Synonym Symbols
RBP6; CRABP-II
NCBI Protein Information
cellular retinoic acid-binding protein 2; cellular retinoic acid-binding protein II
UniProt Protein Name
Cellular retinoic acid-binding protein 2
UniProt Gene Name
CRABP2
UniProt Synonym Gene Names
CRABP-II
UniProt Entry Name
RABP2_HUMAN

NCBI Description

This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]

Uniprot Description

CRABP2: Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; endoplasmic reticulum; cytoplasm; cytosol

Molecular Function: retinoid binding; retinoic acid binding; transporter activity; retinal binding; retinol binding

Biological Process: embryonic forelimb morphogenesis; epidermis development; regulation of transcription, DNA-dependent; retinoic acid metabolic process; signal transduction; transmembrane transport

Research Articles on CRABP2

Similar Products

Product Notes

The CRABP2 crabp2 (Catalog #AAA6374644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-binding Protein II) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRABP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRABP2 crabp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRABP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.