Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NEApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human Capan1 cellsPrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit Alexa Fluor 488Secondary antibody dilution:1:200)

Rabbit CPT1B Polyclonal Antibody | anti-CPT1B antibody

CPT1B antibody - middle region

Gene Names
CPT1B; CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CPT1B; Polyclonal Antibody; CPT1B antibody - middle region; anti-CPT1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Sequence Length
772
Applicable Applications for anti-CPT1B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NEApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human Capan1 cellsPrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit Alexa Fluor 488Secondary antibody dilution:1:200)

Immunohistochemistry (IHC) (rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NEApplication: IHCSpecies+tissue/cell type:Species+tissue/cell type: Human Capan1 cellsPrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit Alexa Fluor 488Secondary antibody dilution:1:200)

Western Blot (WB)

(Host: MouseTarget Name: CPT1BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: CPT1BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CPT1BSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CPT1BSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CPT1BSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CPT1BSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CPT1BSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CPT1BSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CPT1BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CPT1BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Sample Type :1: 45ug human capan1 cell lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit HRPSecondary Antibody Dilution :1:5000Color/Signal Descriptions :ARP46444-QC16367-WB-image-02Gene Name :CPT1BSubmitted by :Dr. Pankaj Kumar Singh, UNMC, Omaha, NE)

Western Blot (WB) (Sample Type :1: 45ug human capan1 cell lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit HRPSecondary Antibody Dilution :1:5000Color/Signal Descriptions :ARP46444-QC16367-WB-image-02Gene Name :CPT1BSubmitted by :Dr. Pankaj Kumar Singh, UNMC, Omaha, NE)

Western Blot (WB)

(WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateCPT1B is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateCPT1B is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-CPT1B antibody
This is a rabbit polyclonal antibody against CPT1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Product Categories/Family for anti-CPT1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
carnitine O-palmitoyltransferase 1, muscle isoform isoform a
NCBI Official Synonym Full Names
carnitine palmitoyltransferase 1B
NCBI Official Symbol
CPT1B
NCBI Official Synonym Symbols
CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1
NCBI Protein Information
carnitine O-palmitoyltransferase 1, muscle isoform
UniProt Protein Name
Carnitine O-palmitoyltransferase 1, muscle isoform
UniProt Gene Name
CPT1B
UniProt Synonym Gene Names
KIAA1670; CPT1-M; CPT I; CPTI-M
UniProt Entry Name
CPT1B_HUMAN

NCBI Description

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. [provided by RefSeq, Jun 2009]

Uniprot Description

CPT1B: a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. [provided by RefSeq, Jun 2009]

Protein type: Lipid Metabolism - fatty acid; Membrane protein, multi-pass; Membrane protein, integral; Transferase; EC 2.3.1.21

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: mitochondrial outer membrane; mitochondrion; integral to membrane

Molecular Function: carnitine O-palmitoyltransferase activity

Biological Process: fatty acid beta-oxidation; cellular lipid metabolic process; carnitine shuttle

Research Articles on CPT1B

Similar Products

Product Notes

The CPT1B cpt1b (Catalog #AAA3208213) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPT1B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CPT1B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CPT1B cpt1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLEMQFQRIL DDPSPPQPGE EKLAALTAGG RVEWAQARQA FFSSGKNKAA. It is sometimes possible for the material contained within the vial of "CPT1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.