Western Blot (WB)
(CORO2B polyclonal antibody. Western Blot analysis of CORO2B expression in A-431.)
Mouse anti-Human CORO2B Polyclonal Antibody | anti-coro2b antibody
CORO2B (KIAA0925, Coronin-2B, Coronin-like Protein C, Protein FC96)
Gene Names
coro2b; Coronin-2B
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
CORO2B; Polyclonal Antibody; CORO2B (KIAA0925; Coronin-2B; Coronin-like Protein C; Protein FC96); Anti -CORO2B (KIAA0925; anti-coro2b antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CORO2B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLVTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRRSDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC
Applicable Applications for anti-coro2b antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human CORO2B, aa1-475 (AAH26335.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CORO2B polyclonal antibody. Western Blot analysis of CORO2B expression in A-431.)
Western Blot (WB)
(CORO2B polyclonal antibody. Western Blot analysis of CORO2B expression in A-431.)
Western Blot (WB)
(Western Blot analysis of CORO2B expression in transfected 293T cell line by CORO2B polyclonal antibody. Lane 1: CORO2B transfected lysate (52.25kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CORO2B expression in transfected 293T cell line by CORO2B polyclonal antibody. Lane 1: CORO2B transfected lysate (52.25kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-coro2b antibody
CORO2B may play a role in the reorganization of neuronal actin structure.
Product Categories/Family for anti-coro2b antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
55,109 Da
NCBI Official Full Name
coro2b protein
NCBI Official Synonym Full Names
coronin, actin binding protein, 2B
NCBI Official Symbol
coro2b
NCBI Official Synonym Symbols
Coronin-2B
NCBI Protein Information
coronin-2B
UniProt Protein Name
Coronin-2B
Protein Family
UniProt Gene Name
coro2b
UniProt Entry Name
COR2B_XENTR
Uniprot Description
Function: May play a role in the reorganization of neuronal actin structure
By similarity.
Subcellular location: Cytoplasm › cytoskeleton
By similarity.
Sequence similarities: Belongs to the WD repeat coronin family.Contains 5 WD repeats.
Similar Products
Product Notes
The coro2b coro2b (Catalog #AAA6011176) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CORO2B (KIAA0925, Coronin-2B, Coronin-like Protein C, Protein FC96) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CORO2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the coro2b coro2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSWRPQYRSS KFRNVYGKVA NREHCFDGIP ITKNVHDNHF CAVNTRFLAI VTESAGGGSF LVIPLEQTGR IEPNYPKVCG HQGNVLDIKW NPFIDNIIAS CSEDTSVRIW EIPEGGLKRN MTEALLELHG HSRRVGLVEW HPTTNNILFS AGYDYKVLIW NLDVGEPVKM IDCHTDVILC MSFNTDGSLL TTTCKDKKLR VIEPRSGRVL QEANCKNHRV NRVVFLGNMK RLVTTGVSRW NTRQIALWDQ EDLSMPLIEE EIDGLSGLLF PFYDADTHML YLAGKGDGNI RYYEISTEKP YLSYLMEFRS PAPQKGLGVM PKHGLDVSAC EVFRFYKLVT LKGLIEPISM IVPRRSDSYQ EDIYPMTPGT EPALTPDEWL GGINRDPVLM SLKEGYKKSS KMVFKAPIKE KKSVVVNGID LLENVPPRTE NELLRMFFRQ QDEIRRLKEE LAQKDIRIRQ LQLELKNLRN SPKNC. It is sometimes possible for the material contained within the vial of "CORO2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
