Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Cornulin antibody (MBS839806) used at 1 ug/ml to detect target protein.)

Rabbit Cornulin Polyclonal Antibody | anti-CRNN antibody

Cornulin antibody

Gene Names
CRNN; DRC1; PDRC1; SEP53; C1orf10
Applications
Western Blot
Purity
Affinity purified
Synonyms
Cornulin; Polyclonal Antibody; Cornulin antibody; Polyclonal Cornulin; Anti-Cornulin; PDRC1; CRNN; SEP53; C1orf10; anti-CRNN antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Cornulin antibody was raised against the middle region of CRNN
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRNN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
495
Applicable Applications for anti-CRNN antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
Cross-Reactivity
Human
Immunogen
Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Cornulin antibody (MBS839806) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Cornulin antibody (MBS839806) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CRNN antibody
Rabbit polyclonal Cornulin antibody raised against the middle region of CRNN
Product Categories/Family for anti-CRNN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
cornulin
NCBI Official Synonym Full Names
cornulin
NCBI Official Symbol
CRNN
NCBI Official Synonym Symbols
DRC1; PDRC1; SEP53; C1orf10
NCBI Protein Information
cornulin
UniProt Protein Name
Cornulin
Protein Family
UniProt Gene Name
CRNN
UniProt Synonym Gene Names
C1orf10; DRC1; PDRC1; SEP53
UniProt Entry Name
CRNN_HUMAN

NCBI Description

This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation. [provided by RefSeq, Jan 2009]

Uniprot Description

CRNN: Survival factor that participates in the clonogenicity of squamous esophageal epithelium cell lines, attenuates deoxycholic acid (DCA)-induced apoptotic cell death and release of calcium. When overexpressed in oral squamous carcinom cell lines, regulates negatively cell proliferation by the induction of G1 arrest. Belongs to the S100-fused protein family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: membrane; cytoplasm

Molecular Function: calcium ion binding

Biological Process: cell-cell adhesion; response to heat

Research Articles on CRNN

Similar Products

Product Notes

The CRNN crnn (Catalog #AAA839806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cornulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CRNN crnn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cornulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.