Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (COQ2 antibody (MBS5301938) used at 1 ug/ml to detect target protein.)

Rabbit COQ2 Polyclonal Antibody | anti-COQ2 antibody

COQ2 antibody

Gene Names
COQ2; MSA1; CL640; COQ10D1; PHB:PPT
Applications
Western Blot
Purity
Affinity purified
Synonyms
COQ2; Polyclonal Antibody; COQ2 antibody; Polyclonal COQ2; Anti-COQ2; COQ-2; COQ 2; FLJ26072; Coenzyme Q2 Homolog Prenyltransferase; CL640; anti-COQ2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COQ2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
371
Applicable Applications for anti-COQ2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.
Cross-Reactivity
Human
Immunogen
COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(COQ2 antibody (MBS5301938) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (COQ2 antibody (MBS5301938) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-COQ2 antibody
Rabbit polyclonal COQ2 antibody
Product Categories/Family for anti-COQ2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
42 kDa (MW of target protein)
NCBI Official Full Name
COQ2 protein
NCBI Official Synonym Full Names
coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
NCBI Official Symbol
COQ2
NCBI Official Synonym Symbols
MSA1; CL640; COQ10D1; PHB:PPT
NCBI Protein Information
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Protein Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Gene Name
COQ2
UniProt Synonym Gene Names
4-HB polyprenyltransferase; hCOQ2; PHB:PPT; PHB:polyprenyltransferase
UniProt Entry Name
COQ2_HUMAN

NCBI Description

This gene encodes an enzyme that functions in the final steps in the biosynthesis of CoQ (ubiquinone), a redox carrier in the mitochondrial respiratory chain and a lipid-soluble antioxidant. This enzyme, which is part of the coenzyme Q10 pathway, catalyzes the prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations in this gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009]

Uniprot Description

COQ2: Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB. Defects in COQ2 are the cause of coenzyme Q10 deficiency, primary, type 1 (COQ10D1). An autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form. Belongs to the UbiA prenyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transferase; Membrane protein, integral; EC 2.5.1.39; Mitochondrial; Cofactor and Vitamin Metabolism - ubiquinone and other terpenoid-quinone biosynthesis

Chromosomal Location of Human Ortholog: 4q21.23

Cellular Component: mitochondrial inner membrane; integral to membrane

Molecular Function: 4-hydroxybenzoate decaprenyltransferase activity; 4-hydroxybenzoate nonaprenyltransferase activity

Biological Process: ubiquinone biosynthetic process; isoprenoid biosynthetic process; glycerol metabolic process

Disease: Multiple System Atrophy 1, Susceptibility To; Coenzyme Q10 Deficiency, Primary, 1

Research Articles on COQ2

Similar Products

Product Notes

The COQ2 coq2 (Catalog #AAA5301938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COQ2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the COQ2 coq2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COQ2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.