Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-COPG2 Polyclonal Antibody)

Rabbit COPG2 Polyclonal Antibody | anti-COPG2 antibody

COPG2 Polyclonal Antibody

Gene Names
COPG2; 2-COP; gamma-2-COP
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
COPG2; Polyclonal Antibody; COPG2 Polyclonal Antibody; 2-COP; gamma-2-COP; coatomer subunit gamma-2; anti-COPG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.87 mg/ml (varies by lot)
Sequence Length
871
Applicable Applications for anti-COPG2 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 542-871 of human COPG2 (NP_036265.3).
Immunogen Sequence
LNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG
Positive Samples
U-251MG, OVCAR3, Rat Brain
Cellular Location
COPI-Coated Vesicle Membrane, Cytoplasm, Cytoplasmic Side, Cytoplasmic Vesicle, Golgi Apparatus Membrane, Peripheral Membrane Protein, Cytosol
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-COPG2 Polyclonal Antibody)

Western Blot (WB) (Western blot-COPG2 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 81kDa; 97kDa
Observed: 105kDa
NCBI Official Full Name
Coatomer subunit gamma-2
NCBI Official Synonym Full Names
coatomer protein complex subunit gamma 2
NCBI Official Symbol
COPG2
NCBI Official Synonym Symbols
2-COP; gamma-2-COP
NCBI Protein Information
coatomer subunit gamma-2
UniProt Protein Name
Coatomer subunit gamma-2
Protein Family
UniProt Gene Name
COPG2
UniProt Synonym Gene Names
Gamma-2-COP
UniProt Entry Name
COPG2_HUMAN

Uniprot Description

COPG2: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. Belongs to the COPG family.

Protein type: Motility/polarity/chemotaxis; Vesicle

Chromosomal Location of Human Ortholog: 7q32

Cellular Component: COPI vesicle coat; cytosol

Molecular Function: structural molecule activity

Biological Process: intra-Golgi vesicle-mediated transport; intracellular protein transport; retrograde vesicle-mediated transport, Golgi to ER

Research Articles on COPG2

Similar Products

Product Notes

The COPG2 copg2 (Catalog #AAA9140527) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COPG2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COPG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the COPG2 copg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COPG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.