Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COL2A1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human COL2A1 Polyclonal Antibody | anti-COL2A1 antibody

COL2A1 Antibody - C-terminal region

Gene Names
COL2A1; AOM; ANFH; SEDC; STL1; COL11A3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
COL2A1; Polyclonal Antibody; COL2A1 Antibody - C-terminal region; anti-COL2A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETING
Sequence Length
1418
Applicable Applications for anti-COL2A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human COL2A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COL2A1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COL2A1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-COL2A1 antibody
This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.
Product Categories/Family for anti-COL2A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134 kDa
NCBI Official Full Name
collagen alpha-1(II) chain isoform 1
NCBI Official Synonym Full Names
collagen type II alpha 1 chain
NCBI Official Symbol
COL2A1
NCBI Official Synonym Symbols
AOM; ANFH; SEDC; STL1; COL11A3
NCBI Protein Information
collagen alpha-1(II) chain
UniProt Protein Name
Collagen alpha-1(II) chain
UniProt Gene Name
COL2A1
UniProt Entry Name
CO2A1_HUMAN

NCBI Description

This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

COL2A1: the alpha-1 chain of type II collagen, an extra-cellular matrix protein found in cartilage and the vitreous humor of the eye. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressive forces. Chondrocalcin is the calcium binding C-propeptide of this collagen molecule. Defects in this protein are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. There are two transcripts identified for this gene. Belongs to the fibrillar collagen family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Extracellular matrix; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q13.11

Cellular Component: extracellular matrix; extracellular space; collagen type II; endoplasmic reticulum lumen; extracellular region; basement membrane

Molecular Function: identical protein binding; metal ion binding; platelet-derived growth factor binding; extracellular matrix structural constituent conferring tensile strength

Biological Process: heart morphogenesis; axon guidance; proteoglycan metabolic process; extracellular matrix organization and biogenesis; inner ear morphogenesis; collagen fibril organization; central nervous system development; palate development; notochord development; limb bud formation; collagen catabolic process; extracellular matrix disassembly; sensory perception of sound; visual perception; regulation of gene expression; cartilage development; tissue homeostasis; chondrocyte differentiation; skeletal development; endochondral ossification; cartilage condensation

Disease: Achondrogenesis, Type Ii; Kniest Dysplasia; Spondyloperipheral Dysplasia; Legg-calve-perthes Disease; Epiphyseal Dysplasia, Multiple, With Myopia And Conductive Deafness; Osteoarthritis With Mild Chondrodysplasia; Stickler Syndrome, Type I; Czech Dysplasia; Platyspondylic Lethal Skeletal Dysplasia, Torrance Type; Otospondylomegaepiphyseal Dysplasia; Spondyloepimetaphyseal Dysplasia, Strudwick Type; Avascular Necrosis Of Femoral Head, Primary; Spondyloepiphyseal Dysplasia Congenita; Stickler Syndrome, Type I, Nonsyndromic Ocular

Research Articles on COL2A1

Similar Products

Product Notes

The COL2A1 col2a1 (Catalog #AAA3223125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL2A1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL2A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COL2A1 col2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTLDAMKVFC NMETGETCVY PNPANVPKKN WWSSKSKEKK HIWFGETING. It is sometimes possible for the material contained within the vial of "COL2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.