Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CNTN2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CNTN2 Polyclonal Antibody | anti-CNTN2 antibody

CNTN2 Antibody - middle region

Gene Names
CNTN2; AXT; TAX; TAX1; FAME5; TAG-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CNTN2; Polyclonal Antibody; CNTN2 Antibody - middle region; anti-CNTN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKY
Sequence Length
1040
Applicable Applications for anti-CNTN2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CNTN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CNTN2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNTN2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CNTN2 antibody
The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
contactin-2
NCBI Official Synonym Full Names
contactin 2
NCBI Official Symbol
CNTN2
NCBI Official Synonym Symbols
AXT; TAX; TAX1; FAME5; TAG-1
NCBI Protein Information
contactin-2
UniProt Protein Name
Contactin-2
Protein Family
UniProt Gene Name
CNTN2
UniProt Synonym Gene Names
AXT; TAG1; TAX1; TAX-1
UniProt Entry Name
CNTN2_HUMAN

NCBI Description

This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. [provided by RefSeq, Sep 2016]

Uniprot Description

CNTN2: May play a role in the initial growth and guidance of axons. May be involved in cell adhesion. Belongs to the immunoglobulin superfamily. Contactin family.

Protein type: Membrane protein, GPI anchor; Cell adhesion

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: voltage-gated potassium channel complex; cell surface; cell soma; integral to plasma membrane; plasma membrane; synapse; myelin sheath

Molecular Function: identical protein binding; protein self-association; carbohydrate binding; glycoprotein binding

Biological Process: axon guidance; cerebral cortex GABAergic interneuron migration; myelination in the central nervous system; positive regulation of adenosine receptor signaling pathway; axonal fasciculation; regulation of astrocyte differentiation; microtubule cytoskeleton organization and biogenesis; learning; adult walking behavior; negative regulation of neuron differentiation; receptor internalization; clustering of voltage-gated potassium channels; regulation of axon diameter; cell adhesion; regulation of neuronal synaptic plasticity

Disease: Epilepsy, Familial Adult Myoclonic, 5

Research Articles on CNTN2

Similar Products

Product Notes

The CNTN2 cntn2 (Catalog #AAA3222460) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNTN2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNTN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNTN2 cntn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTMDLTFTWT LDDFPIDFDK PGGHYRRTNV KETIGDLTIL NAQLRHGGKY. It is sometimes possible for the material contained within the vial of "CNTN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.