Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CNTF expression in transfected 293T cell line by CNTF polyclonal antibody. Lane 1: CNTF transfected lysate (22.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CNTF Polyclonal Antibody | anti-CNTF antibody

CNTF (Ciliary Neurotrophic Factor, HCNTF) (PE)

Gene Names
CNTF; HCNTF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNTF; Polyclonal Antibody; CNTF (Ciliary Neurotrophic Factor; HCNTF) (PE); anti-CNTF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CNTF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CNTF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CNTF, aa1-200 (NP_000605.1).
Immunogen Sequence
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CNTF expression in transfected 293T cell line by CNTF polyclonal antibody. Lane 1: CNTF transfected lysate (22.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CNTF expression in transfected 293T cell line by CNTF polyclonal antibody. Lane 1: CNTF transfected lysate (22.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CNTF antibody
CNTF mainly signals through binding to a receptor complex consisting of a CNTFRa subunit, two beta components, gp130 and LIFR, resulting ultimately in the activation of JAK/STAT signalling pathway, but CNTF has also been shown to bind to the receptor for interleukin-6 (IL-6R).
Product Categories/Family for anti-CNTF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,931 Da
NCBI Official Full Name
ciliary neurotrophic factor
NCBI Official Synonym Full Names
ciliary neurotrophic factor
NCBI Official Symbol
CNTF
NCBI Official Synonym Symbols
HCNTF
NCBI Protein Information
ciliary neurotrophic factor
UniProt Protein Name
Ciliary neurotrophic factor
UniProt Gene Name
CNTF
UniProt Synonym Gene Names
CNTF
UniProt Entry Name
CNTF_HUMAN

NCBI Description

The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]

Uniprot Description

CNTF: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. Belongs to the CNTF family.

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: interleukin-6 receptor binding; growth factor activity; ciliary neurotrophic factor receptor binding

Biological Process: negative regulation of photoreceptor cell differentiation; positive regulation of cell proliferation; regulation of retinal cell programmed cell death; neuron development; negative regulation of neuron apoptosis; signal transduction; muscle morphogenesis; growth; positive regulation of tyrosine phosphorylation of Stat3 protein

Research Articles on CNTF

Similar Products

Product Notes

The CNTF cntf (Catalog #AAA6374301) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNTF (Ciliary Neurotrophic Factor, HCNTF) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNTF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNTF cntf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNTF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.