Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CNN2 expression in transfected 293T cell line by CNN2 polyclonal antibody. Lane 1: CNN2 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CNN2 Polyclonal Antibody | anti-CNN2 antibody

CNN2 (Calponin-2, Calponin H2, Smooth Muscle, Neutral Calponin, Calponin 2) (HRP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNN2; Polyclonal Antibody; CNN2 (Calponin-2; Calponin H2; Smooth Muscle; Neutral Calponin; Calponin 2) (HRP); anti-CNN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CNN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-CNN2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CNN2, aa1-270 (NP_958434.1).
Immunogen Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CNN2 expression in transfected 293T cell line by CNN2 polyclonal antibody. Lane 1: CNN2 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CNN2 expression in transfected 293T cell line by CNN2 polyclonal antibody. Lane 1: CNN2 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CNN2 antibody
Calponin-2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The protein could play a role in smooth muscle contraction and cell adhesion.
Product Categories/Family for anti-CNN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,621 Da
NCBI Official Full Name
calponin-2 isoform b
NCBI Official Synonym Full Names
calponin 2
NCBI Official Symbol
CNN2
NCBI Protein Information
calponin-2; neutral calponin; calponin H2, smooth muscle
UniProt Protein Name
Calponin 2 isoform a variant
Protein Family
UniProt Entry Name
Q53GK7_HUMAN

Uniprot Description

calponin 2: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. Belongs to the calponin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoskeleton; focal adhesion; membrane; stress fiber; intercellular junction

Molecular Function: calmodulin binding; actin binding

Biological Process: negative regulation of phagocytosis; regulation of actin filament-based process; wound healing; actomyosin structure organization and biogenesis; hemopoiesis; cytoskeleton organization and biogenesis; negative regulation of cell migration; regulation of cell proliferation

Similar Products

Product Notes

The CNN2 (Catalog #AAA6374262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNN2 (Calponin-2, Calponin H2, Smooth Muscle, Neutral Calponin, Calponin 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.