Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CNGB3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CNGB3 Polyclonal Antibody | anti-CNGB3 antibody

CNGB3 Antibody - N-terminal region

Gene Names
CNGB3; ACHM1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNGB3; Polyclonal Antibody; CNGB3 Antibody - N-terminal region; anti-CNGB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPAAPVINEYADAQLH
Sequence Length
809
Applicable Applications for anti-CNGB3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CNGB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CNGB3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNGB3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CNGB3 antibody
This is a rabbit polyclonal antibody against CNGB3. It was validated on Western Blot

Target Description: This gene encodes the beta subunit of a cyclic nucleotide-gated ion channel. The encoded beta subunit appears to play a role in modulation of channel function in cone photoreceptors. This heterotetrameric channel is necessary for sensory transduction, and mutations in this gene have been associated with achromatopsia 3, progressive cone dystrophy, and juvenile macular degeneration, also known as Stargardt Disease.
Product Categories/Family for anti-CNGB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
cyclic nucleotide-gated cation channel beta-3
NCBI Official Synonym Full Names
cyclic nucleotide gated channel beta 3
NCBI Official Symbol
CNGB3
NCBI Official Synonym Symbols
ACHM1
NCBI Protein Information
cyclic nucleotide-gated cation channel beta-3
UniProt Protein Name
Cyclic nucleotide-gated cation channel beta-3
UniProt Gene Name
CNGB3
UniProt Synonym Gene Names
CNG channel beta-3

NCBI Description

This gene encodes the beta subunit of a cyclic nucleotide-gated ion channel. The encoded beta subunit appears to play a role in modulation of channel function in cone photoreceptors. This heterotetrameric channel is necessary for sensory transduction, and mutations in this gene have been associated with achromatopsia 3, progressive cone dystrophy, and juvenile macular degeneration, also known as Stargardt Disease. [provided by RefSeq, Feb 2010]

Uniprot Description

Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficiency of the channel when coexpressed with CNGA3 (). Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones.

Research Articles on CNGB3

Similar Products

Product Notes

The CNGB3 cngb3 (Catalog #AAA3219477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNGB3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNGB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNGB3 cngb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TNPDPQNAAE PTGTVPEQKE MDPGKEGPNS PQNKPPAAPV INEYADAQLH. It is sometimes possible for the material contained within the vial of "CNGB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.