Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CNGA4Sample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CNGA4 Polyclonal Antibody | anti-CNGA4 antibody

CNGA4 Antibody - N-terminal region

Gene Names
CNGA4; CNG4; CNG5; CNCA2; CNG-4; CNGB2; OCNC2; OCNCb; OCNCBETA
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNGA4; Polyclonal Antibody; CNGA4 Antibody - N-terminal region; anti-CNGA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ
Sequence Length
416
Applicable Applications for anti-CNGA4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CNGA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CNGA4Sample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNGA4Sample Type: Fetal Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CNGA4 antibody
This is a rabbit polyclonal antibody against CNGA4. It was validated on Western Blot

Target Description: CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals。
Product Categories/Family for anti-CNGA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
cyclic nucleotide-gated cation channel alpha-4
NCBI Official Synonym Full Names
cyclic nucleotide gated channel alpha 4
NCBI Official Symbol
CNGA4
NCBI Official Synonym Symbols
CNG4; CNG5; CNCA2; CNG-4; CNGB2; OCNC2; OCNCb; OCNCBETA
NCBI Protein Information
cyclic nucleotide-gated cation channel alpha-4
UniProt Protein Name
Cyclic nucleotide-gated cation channel alpha-4
UniProt Gene Name
CNGA4
UniProt Synonym Gene Names
CNG channel alpha-4; CNG-4; CNG4
UniProt Entry Name
CNGA4_HUMAN

NCBI Description

CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM, Mar 2008]

Uniprot Description

CNGA4: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection. Belongs to the cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. CNGA4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: Golgi membrane; integral to plasma membrane

Molecular Function: voltage-gated potassium channel activity; intracellular cAMP activated cation channel activity; intracellular cGMP activated cation channel activity; cGMP binding; cAMP binding

Biological Process: phototransduction, visible light; regulation of membrane potential; organelle organization and biogenesis; sensory perception of smell

Similar Products

Product Notes

The CNGA4 cnga4 (Catalog #AAA3207556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNGA4 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNGA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNGA4 cnga4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIAKLMLYIF VVIHWNSCLY FALSRYLGFG RDAWVYPDPA QPGFERLRRQ. It is sometimes possible for the material contained within the vial of "CNGA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.