Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CNGA3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CNGA3 Polyclonal Antibody | anti-CNGA3 antibody

CNGA3 Antibody - middle region

Gene Names
CNGA3; CNG3; ACHM2; CCNC1; CCNCa; CNCG3; CCNCalpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CNGA3; Polyclonal Antibody; CNGA3 Antibody - middle region; anti-CNGA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVFYNWYLLICR
Sequence Length
694
Applicable Applications for anti-CNGA3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CNGA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CNGA3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNGA3Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CNGA3 antibody
This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.
Product Categories/Family for anti-CNGA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76 kDa
NCBI Official Full Name
cyclic nucleotide-gated cation channel alpha-3 isoform 2
NCBI Official Synonym Full Names
cyclic nucleotide gated channel alpha 3
NCBI Official Symbol
CNGA3
NCBI Official Synonym Symbols
CNG3; ACHM2; CCNC1; CCNCa; CNCG3; CCNCalpha
NCBI Protein Information
cyclic nucleotide-gated cation channel alpha-3
UniProt Protein Name
Cyclic nucleotide-gated cation channel alpha-3
UniProt Gene Name
CNGA3
UniProt Synonym Gene Names
CNCG3; CNG channel alpha-3; CNG-3; CNG3
UniProt Entry Name
CNGA3_HUMAN

NCBI Description

This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

CNGA3: Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones. Defects in CNGA3 are the cause of achromatopsia type 2 (ACHM2); also known as total colorblindness or rod monochromacy (RMCH2). ACHM2 is an autosomal recessive condition characterized by day blindness and photophobia. In ACHM2 patients the cones are defective and the subjects see better at night. Defects in CNGA3 may be a cause of Leber congenital amaurosis (LCA), a severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near- absent pupillary responses, photophobia, high hyperopia and keratoconus. Belongs to the cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. CNGA3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: integral to plasma membrane; cytoplasm; dendrite; perikaryon

Molecular Function: protein C-terminus binding; voltage-gated potassium channel activity; intracellular cAMP activated cation channel activity; intracellular cGMP activated cation channel activity; cGMP binding; ligand-gated ion channel activity

Biological Process: phototransduction, visible light; response to magnesium ion; regulation of membrane potential; response to cAMP; visual perception; retinal cone cell development; transport; signal transduction; cation transport; response to corticosteroid stimulus

Disease: Achromatopsia 2

Research Articles on CNGA3

Similar Products

Product Notes

The CNGA3 cnga3 (Catalog #AAA3221631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNGA3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNGA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNGA3 cnga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTNTSNNTEE EKKTKKKDAI VVDPSSNLYY RWLTAIALPV FYNWYLLICR. It is sometimes possible for the material contained within the vial of "CNGA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.