Western Blot (WB)
(CNDP 1 rabbit polyclonal antibody. Western Blot analysis of CNDP1 expression in HeLa.)
Rabbit anti-Human CNDP1 Polyclonal Antibody | anti-CNDP1 antibody
CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (AP)
Gene Names
CNDP1; CN1; CPGL2; HsT2308
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNDP1; Polyclonal Antibody; CNDP1 (CN1; CPGL2; Beta-Ala-His Dipeptidase; CNDP Dipeptidase 1; Carnosine Dipeptidase 1; Glutamate Carboxypeptidase-like Protein 2; Serum Carnosinase; UNQ1915/PRO4380; MGC102737; MGC10825; MGC142072) (AP); anti-CNDP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CNDP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CNDP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CNDP1, aa1-507 (NP_116038.4).
Immunogen Sequence
MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(CNDP 1 rabbit polyclonal antibody. Western Blot analysis of CNDP1 expression in HeLa.)
Western Blot (WB)
(CNDP 1 rabbit polyclonal antibody. Western Blot analysis of CNDP1 expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of CNDP1 expression in transfected 293T cell line by CNDP1 polyclonal antibody. Lane 1: CNDP1 transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CNDP1 expression in transfected 293T cell line by CNDP1 polyclonal antibody. Lane 1: CNDP1 transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CNDP1 antibody
Preferential hydrolysis of the beta-Ala--His dipeptide (carnosine), and also anserine, Xaa--His dipeptides and other dipeptides including homocarnosine.
Product Categories/Family for anti-CNDP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,706 Da
NCBI Official Full Name
beta-Ala-His dipeptidase
NCBI Official Synonym Full Names
carnosine dipeptidase 1 (metallopeptidase M20 family)
NCBI Official Symbol
CNDP1
NCBI Official Synonym Symbols
CN1; CPGL2; HsT2308
NCBI Protein Information
beta-Ala-His dipeptidase
UniProt Protein Name
Beta-Ala-His dipeptidase
Protein Family
UniProt Gene Name
CNDP1
UniProt Synonym Gene Names
CN1; CPGL2
UniProt Entry Name
CNDP1_HUMAN
Uniprot Description
CNDP1: a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq, Jul 2008]
Protein type: Amino Acid Metabolism - histidine; Protease; Secreted, signal peptide; Secreted; Other Amino Acids Metabolism - beta-alanine; EC 3.4.13.20
Chromosomal Location of Human Ortholog: 18q22.3
Cellular Component: extracellular region
Molecular Function: dipeptidase activity; metallopeptidase activity; carboxypeptidase activity; metal ion binding
Biological Process: proteolysis
Similar Products
Product Notes
The CNDP1 cndp1 (Catalog #AAA6374225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CNDP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNDP1 cndp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNDP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
