Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CLN6 antibody (MBS5302540) used at 1 ug/ml to detect target protein.)

Rabbit CLN6 Polyclonal Antibody | anti-CLN6 antibody

CLN6 antibody

Gene Names
CLN6; nclf; CLN4A; HsT18960
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Affinity purified
Synonyms
CLN6; Polyclonal Antibody; CLN6 antibody; Polyclonal CLN6; Anti-CLN6; CLN 6; FLJ20561; CLN-6; Ceroid-Lipofuscinosis Neuronal 6 Late Infantile Variant; nclf; HsT18960; anti-CLN6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
CLN6 antibody was raised against the middle region of CLN6
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLN6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
311
Applicable Applications for anti-CLN6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids  LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(CLN6 antibody (MBS5302540) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (CLN6 antibody (MBS5302540) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CLN6 antibody
Rabbit polyclonal CLN6 antibody raised against the middle region of CLN6
Product Categories/Family for anti-CLN6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
ceroid-lipofuscinosis neuronal protein 6
NCBI Official Synonym Full Names
ceroid-lipofuscinosis, neuronal 6, late infantile, variant
NCBI Official Symbol
CLN6
NCBI Official Synonym Symbols
nclf; CLN4A; HsT18960
NCBI Protein Information
ceroid-lipofuscinosis neuronal protein 6
UniProt Protein Name
Ceroid-lipofuscinosis neuronal protein 6
UniProt Gene Name
CLN6
UniProt Synonym Gene Names
Protein CLN6
UniProt Entry Name
CLN6_HUMAN

NCBI Description

This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function. [provided by RefSeq, Oct 2008]

Uniprot Description

CLN6: Defects in CLN6 are the cause of neuronal ceroid lipofuscinosis type 6 (CLN6). A form of neuronal ceroid lipofuscinosis. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. The lipopigment patterns observed most often in neuronal ceroid lipofuscinosis type 6 comprise mixed combinations of granular, curvilinear, and fingerprint profiles. Defects in CLN6 are the cause of neuronal ceroid lipofuscinosis type 4A (CLN4A). An adult-onset neuronal ceroid lipofuscinosis. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. CLN4A has no visual involvement and is characterized by progressive myoclonic epilepsy.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; nuclear membrane; intracellular membrane-bound organelle; membrane; endoplasmic reticulum; endoplasmic reticulum lumen; integral to membrane

Molecular Function: protein binding; protein homodimerization activity

Biological Process: cholesterol metabolic process; visual perception; glycosaminoglycan metabolic process; positive regulation of proteolysis; lysosomal lumen acidification; protein catabolic process; locomotion during locomotory behavior; cellular macromolecule catabolic process; ganglioside metabolic process

Disease: Ceroid Lipofuscinosis, Neuronal, 6; Ceroid Lipofuscinosis, Neuronal, 4a, Autosomal Recessive

Research Articles on CLN6

Similar Products

Product Notes

The CLN6 cln6 (Catalog #AAA5302540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLN6 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's CLN6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CLN6 cln6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLN6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.