Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CLIC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)

Rabbit CLIC6 Polyclonal Antibody | anti-CLIC6 antibody

CLIC6 antibody - middle region

Gene Names
CLIC6; CLIC1L
Reactivity
Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLIC6; Polyclonal Antibody; CLIC6 antibody - middle region; anti-CLIC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
Sequence Length
686
Applicable Applications for anti-CLIC6 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CLIC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CLIC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CLIC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CLIC6 antibody
This is a rabbit polyclonal antibody against CLIon Channel6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.
Product Categories/Family for anti-CLIC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
chloride intracellular channel protein 6 isoform 2
NCBI Official Synonym Full Names
chloride intracellular channel 6
NCBI Official Symbol
CLIC6
NCBI Official Synonym Symbols
CLIC1L
NCBI Protein Information
chloride intracellular channel protein 6
UniProt Protein Name
Chloride intracellular channel protein 6
UniProt Gene Name
CLIC6
UniProt Synonym Gene Names
CLIC1L
UniProt Entry Name
CLIC6_HUMAN

NCBI Description

This gene encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2015]

Uniprot Description

CLIC6: May insert into membranes and form chloride ion channels. May play a critical role in water-secreting cells, possibly through the regulation of chloride ion transport. Belongs to the chloride channel CLIC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, chloride; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.12

Cellular Component: cytoplasm; plasma membrane

Molecular Function: protein C-terminus binding; chloride channel activity; protein homodimerization activity; voltage-gated ion channel activity; D4 dopamine receptor binding; D3 dopamine receptor binding; D2 dopamine receptor binding

Research Articles on CLIC6

Similar Products

Product Notes

The CLIC6 clic6 (Catalog #AAA3202561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLIC6 antibody - middle region reacts with Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLIC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLIC6 clic6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RREDGEASEP RALGQEHDIT LFVKAGYDGE SIGNCPFSQR LFMILWLKGV. It is sometimes possible for the material contained within the vial of "CLIC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.