Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CLEC3BSample Tissue: Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CLEC3B Polyclonal Antibody | anti-CLEC3B antibody

CLEC3B Antibody - middle region

Gene Names
CLEC3B; TN; TNA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CLEC3B; Polyclonal Antibody; CLEC3B Antibody - middle region; anti-CLEC3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: FTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLG
Sequence Length
202
Applicable Applications for anti-CLEC3B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CLEC3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLEC3BSample Tissue: Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CLEC3BSample Tissue: Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-CLEC3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
tetranectin isoform 1precursor
NCBI Official Synonym Full Names
C-type lectin domain family 3 member B
NCBI Official Symbol
CLEC3B
NCBI Official Synonym Symbols
TN; TNA
NCBI Protein Information
tetranectin
UniProt Protein Name
Tetranectin
Protein Family
UniProt Gene Name
CLEC3B
UniProt Synonym Gene Names
TNA; TN
UniProt Entry Name
TETN_HUMAN

Uniprot Description

CLEC3B: Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p22-p21.3

Cellular Component: extracellular matrix; extracellular space; granular component; cytoplasm; extracellular region

Molecular Function: heparin binding; calcium ion binding; carbohydrate binding

Biological Process: ossification; skeletal development; bone mineralization

Research Articles on CLEC3B

Similar Products

Product Notes

The CLEC3B clec3b (Catalog #AAA3220435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC3B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLEC3B clec3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTQTKTFHEA SEDCISRGGT LGTPQTGSEN DALYEYLRQS VGNEAEIWLG. It is sometimes possible for the material contained within the vial of "CLEC3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.