Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-Clec1b antibodyFormalin Fixed Paraffin Embedded Tissue: Human Fetal LiverPrimary antibody Concentration: 1:50Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit Clec1b Polyclonal Antibody | anti-CLEC1B antibody

Clec1b antibody - N-terminal region

Gene Names
Clec1b; Clec2; Clec-2; 1810061I13Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Clec1b; Polyclonal Antibody; Clec1b antibody - N-terminal region; anti-CLEC1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL
Sequence Length
229
Applicable Applications for anti-CLEC1B antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 93%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-Clec1b antibodyFormalin Fixed Paraffin Embedded Tissue: Human Fetal LiverPrimary antibody Concentration: 1:50Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-Clec1b antibodyFormalin Fixed Paraffin Embedded Tissue: Human Fetal LiverPrimary antibody Concentration: 1:50Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-CLEC1B antibody
This is a rabbit polyclonal antibody against Clec1b. It was validated on Western Blot

Target Description: Clec1b acts as a receptor for the platelet-aggregating snake venom protein rhodocytin. Rhodocytin binding leads to tyrosine phosphorylation and this promotes the binding of spleen tyrosine kinase (Syk) and initiation of downstream tyrosine phosphorylation events and activation of PLC-gamma-2.
Product Categories/Family for anti-CLEC1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
C-type lectin domain family 1 member B isoform 1
NCBI Official Synonym Full Names
C-type lectin domain family 1, member b
NCBI Official Symbol
Clec1b
NCBI Official Synonym Symbols
Clec2; Clec-2; 1810061I13Rik
NCBI Protein Information
C-type lectin domain family 1 member B
UniProt Protein Name
C-type lectin domain family 1 member B
UniProt Gene Name
Clec1b
UniProt Synonym Gene Names
Clec2; CLEC-2
UniProt Entry Name
CLC1B_MOUSE

Uniprot Description

CLEC1B: Acts as a receptor for the platelet-aggregating snake venom protein rhodocytin. Rhodocytin binding leads to tyrosine phosphorylation and this promotes the binding of spleen tyrosine kinase (Syk) and initiation of downstream tyrosine phosphorylation events and activation of PLC-gamma-2. Acts as an attachment factor for human immunodeficiency virus type 1 (HIV-1) and facilitates its capture by platelets. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Cellular Component: membrane; integral to plasma membrane; integral to membrane

Molecular Function: transmembrane receptor activity; carbohydrate binding

Biological Process: cell surface receptor linked signal transduction; platelet formation; signal transduction

Research Articles on CLEC1B

Similar Products

Product Notes

The CLEC1B clec1b (Catalog #AAA3208497) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Clec1b antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Clec1b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLEC1B clec1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQDEDGYITL NIKPRKQALS SAEPASSWWR VMALVLLISS MGLVVGLVAL. It is sometimes possible for the material contained within the vial of "Clec1b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.