Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CKLF Polyclonal Antibody)

Rabbit anti-Mouse, Rat CKLF Polyclonal Antibody | anti-CKLF antibody

CKLF Polyclonal Antibody

Gene Names
CKLF; C32; CKLF1; CKLF2; CKLF3; CKLF4; UCK-1; HSPC224
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CKLF; Polyclonal Antibody; CKLF Polyclonal Antibody; C32; CKLF1; CKLF2; CKLF3; CKLF4; HSPC224; UCK-1; chemokine-like factor; anti-CKLF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.02 mg/ml (varies by lot)
Sequence Length
113
Applicable Applications for anti-CKLF antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1).
Immunogen Sequence
MDNVQPKIKHRPFCFSVKGHVKMLRLVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Positive Samples
Mouse Thymus, Mouse Testis, Rat Thymus, Rat Testis
Cellular Location
Membrane, Multi-Pass Membrane Protein, Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CKLF Polyclonal Antibody)

Western Blot (WB) (Western blot-CKLF Polyclonal Antibody)
Related Product Information for anti-CKLF antibody
The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CMTM1 (CKLF-like MARVEL transmembrane domain containing 1).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 7kDa; 10kDa; 12kDa; 13kDa; 17kDa
Observed: 13kDa
NCBI Official Full Name
chemokine-like factor isoform e
NCBI Official Synonym Full Names
chemokine like factor
NCBI Official Symbol
CKLF
NCBI Official Synonym Symbols
C32; CKLF1; CKLF2; CKLF3; CKLF4; UCK-1; HSPC224
NCBI Protein Information
chemokine-like factor
UniProt Protein Name
Chemokine-like factor
Protein Family
UniProt Gene Name
CKLF
UniProt Synonym Gene Names
CKLF1
UniProt Entry Name
CKLF_HUMAN

NCBI Description

The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CMTM1 (CKLF-like MARVEL transmembrane domain containing 1).[provided by RefSeq, Feb 2011]

Uniprot Description

CKLF: May play an important role in inflammation and regeneration of skeletal muscle. Partly inhibited by interleukin 10. Belongs to the chemokine-like factor family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis; Chemokine

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: extracellular space; membrane; extracellular region; integral to membrane

Molecular Function: chemokine activity

Biological Process: neutrophil chemotaxis; cell proliferation; lymphocyte chemotaxis; macrophage chemotaxis; secretion by cell

Research Articles on CKLF

Similar Products

Product Notes

The CKLF cklf (Catalog #AAA9140899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CKLF Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CKLF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CKLF cklf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKLF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.