Rabbit anti-Human CIRBP Polyclonal Antibody | anti-CIRBP antibody

CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP) (PE)

Cat. Num. AAA6374015

• Gene Names: CIRBP; CIRP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CIRBP; Polyclonal Antibody; CIRBP (Cold-inducible RNA-binding Protein; A18 hnRNP; Glycine-rich RNA-binding Protein CIRP; A18HNRNP; CIRP) (PE); anti-CIRBP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CIRBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CIRBP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CIRBP, aa1-172 (NP_001271.1).
• Immunogen Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CIRBP expression in transfected 293T cell line by CIRBP polyclonal antibody. Lane 1: CIRBP transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CIRBP antibody

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed.

Product Categories/Family for anti-CIRBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4502847
• NCBI GeneID: 1153
• NCBI Accession #: NP_001271.1
• NCBI GenBank Nucleotide #: NM_001280.1
• UniProt Accession #: Q14011; B3KT17; B4E2X2
• Molecular Weight: 26,130 Da
• NCBI Official Full Name: cold-inducible RNA-binding protein isoform 1
• NCBI Official Synonym Full Names: cold inducible RNA binding protein
• NCBI Official Symbol: CIRBP
• NCBI Official Synonym Symbols: CIRP
• NCBI Protein Information: cold-inducible RNA-binding protein; A18 hnRNP; cold inducible RNA-binding protein; glycine-rich RNA binding protein
• UniProt Protein Name: Cold-inducible RNA-binding protein
• Protein Family: Cold-inducible RNA-binding protein
• UniProt Gene Name: CIRBP
• UniProt Synonym Gene Names: A18HNRNP; CIRP
• UniProt Entry Name: CIRBP_HUMAN

Uniprot Description

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (). Promotes assembly of stress granules (SGs), when overexpressed.