Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TRAF3IP2 rabbit polyclonal antibody. Western Blot analysis of TRAF3IP2 expression in human pancreas.)

Rabbit anti-Human CIKS Polyclonal Antibody | anti-CIKS antibody

CIKS (Connection to IKK and SAPK/JNK, ACT1, Adapter Protein CIKS, C6orf2, C6orf4, C6orf5, C6orf6, DKFZP586G0522, MGC3581, Nuclear Factor NF-kappa-B Activator 1, TRAF3 Interacting Protein 2, TRAF3IP2) (Biotin)

Gene Names
TRAF3IP2; ACT1; CIKS; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; PSORS13
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CIKS; Polyclonal Antibody; CIKS (Connection to IKK and SAPK/JNK; ACT1; Adapter Protein CIKS; C6orf2; C6orf4; C6orf5; C6orf6; DKFZP586G0522; MGC3581; Nuclear Factor NF-kappa-B Activator 1; TRAF3 Interacting Protein 2; TRAF3IP2) (Biotin); anti-CIKS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TRAF3IP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CIKS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TRAF3IP2, aa1-565 (NP_679211.1).
Immunogen Sequence
MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TRAF3IP2 rabbit polyclonal antibody. Western Blot analysis of TRAF3IP2 expression in human pancreas.)

Western Blot (WB) (TRAF3IP2 rabbit polyclonal antibody. Western Blot analysis of TRAF3IP2 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of TRAF3IP2 expression in transfected 293T cell line by TRAF3IP2 polyclonal antibody. Lane 1: TRAF3IP2 transfected lysate (63.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRAF3IP2 expression in transfected 293T cell line by TRAF3IP2 polyclonal antibody. Lane 1: TRAF3IP2 transfected lysate (63.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CIKS antibody
Nuclear factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB associates with IkB proteins in the cell cytoplasm, which inhibit NF-kB activity. IkB is phosphorylated by IkB kinase (IKK) complex that contains IKKa, IKKb, and IKKg. A novel molecule that associates with and activates IKK was recently identified and designated CIKS (for connection to IKK and SAPK/JNK) and Act1 (for NF-kB activator 1). CIKS directly interacts with IKKg. CIKS/Act1 also activates activating transcription factor (ATF) and activator protein 1 (AP-1) through Jun kinase (JNK). These results indicate that CIKS/Act1 is involved in the inflammation and stress responses. CIKS/Act1 is ubiquitously expressed in human tissues.
Product Categories/Family for anti-CIKS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,457 Da
NCBI Official Full Name
TRAF3 interacting protein 2 isoform 2
NCBI Official Synonym Full Names
TRAF3 interacting protein 2
NCBI Official Symbol
TRAF3IP2
NCBI Official Synonym Symbols
ACT1; CIKS; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; PSORS13
NCBI Protein Information
adapter protein CIKS

NCBI Description

This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq, Aug 2009]

Research Articles on CIKS

Similar Products

Product Notes

The CIKS (Catalog #AAA6373996) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIKS (Connection to IKK and SAPK/JNK, ACT1, Adapter Protein CIKS, C6orf2, C6orf4, C6orf5, C6orf6, DKFZP586G0522, MGC3581, Nuclear Factor NF-kappa-B Activator 1, TRAF3 Interacting Protein 2, TRAF3IP2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIKS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CIKS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CIKS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.