Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHX10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Rabbit CHX10 Polyclonal Antibody | anti-VSX2 antibody

CHX10 antibody - C-terminal region

Gene Names
VSX2; RET1; CHX10; HOX10; MCOP2; MCOPCB3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHX10; Polyclonal Antibody; CHX10 antibody - C-terminal region; anti-VSX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Sequence Length
361
Applicable Applications for anti-VSX2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHX10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CHX10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)
Related Product Information for anti-VSX2 antibody
This is a rabbit polyclonal antibody against CHX10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
visual system homeobox 2
NCBI Official Synonym Full Names
visual system homeobox 2
NCBI Official Symbol
VSX2
NCBI Official Synonym Symbols
RET1; CHX10; HOX10; MCOP2; MCOPCB3
NCBI Protein Information
visual system homeobox 2
UniProt Protein Name
Visual system homeobox 2
Protein Family
UniProt Gene Name
VSX2
UniProt Synonym Gene Names
CHX10; HOX10
UniProt Entry Name
VSX2_HUMAN

NCBI Description

This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009]

Uniprot Description

Function: Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells

By similarity.

Subcellular location: Nucleus.

Tissue specificity: Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate.

Involvement in disease: Microphthalmia, isolated, 2 (MCOP2) [MIM:610093]: A disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6 Ref.7Microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092]: A disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1Microphthalmia, isolated, with coloboma, 3 (MCOPCB3) [MIM:610092]: A disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure).Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6

Sequence similarities: Belongs to the paired homeobox family.Contains 1 CVC domain.Contains 1 homeobox DNA-binding domain.

Research Articles on VSX2

Similar Products

Product Notes

The VSX2 vsx2 (Catalog #AAA3200677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHX10 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHX10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VSX2 vsx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESILKSAKDG IMDSCAPWLL GMHKKSLEAA AESGRKPEGE RQALPKLDKM. It is sometimes possible for the material contained within the vial of "CHX10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.