Rabbit anti-Human CHUK Polyclonal Antibody | anti-CHUK antibody

CHUK Antibody - middle region

Cat. Num. AAA3221174

• Gene Names: CHUK; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CHUK; Polyclonal Antibody; CHUK Antibody - middle region; anti-CHUK antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDR
• Sequence Length: 745

• Applicable Applications for anti-CHUK antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHUK
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CHUK AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: CHUKSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CHUK antibody

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.

Product Categories/Family for anti-CHUK antibody

Polyclonal; Transcription Regulation; Protein Kinases; E3 & Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 62241001
• NCBI GeneID: 1147
• NCBI Accession #: NP_001269.3
• NCBI GenBank Nucleotide #: NM_001278.3
• UniProt Accession #: O15111
• Molecular Weight: 82 kDa
• NCBI Official Full Name: inhibitor of nuclear factor kappa-B kinase subunit alpha isoform 1
• NCBI Official Synonym Full Names: component of inhibitor of nuclear factor kappa B kinase complex
• NCBI Official Symbol: CHUK
• NCBI Official Synonym Symbols: IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha
• NCBI Protein Information: inhibitor of nuclear factor kappa-B kinase subunit alpha
• UniProt Protein Name: Inhibitor of nuclear factor kappa-B kinase subunit alpha
• Protein Family: Inhibitor of nuclear factor kappa-B kinase
• UniProt Gene Name: CHUK
• UniProt Synonym Gene Names: IKKA; TCF16; I-kappa-B kinase alpha; IKK-A; IKK-alpha; IkBKA; IkappaB kinase; IKK1; NFKBIKA; TCF-16
• UniProt Entry Name: IKKA_HUMAN

NCBI Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008]