Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHST8Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CHST8 Polyclonal Antibody | anti-CHST8 antibody

CHST8 Antibody - N-terminal region

Gene Names
CHST8; PSS3; GalNAc4ST; GALNAC4ST1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHST8; Polyclonal Antibody; CHST8 Antibody - N-terminal region; anti-CHST8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR
Sequence Length
424
Applicable Applications for anti-CHST8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human CHST8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHST8Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHST8Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHST8 antibody
The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. It is responsible for sulfation of GalNAc on luteinizing hormone (LH), which is required for production of the sex hormones. Mice lacking this enzyme, exhibit increased levels of circulating LH, and precocious sexual maturation of both male and female mice. Alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
carbohydrate sulfotransferase 8
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 8
NCBI Official Symbol
CHST8
NCBI Official Synonym Symbols
PSS3; GalNAc4ST; GALNAC4ST1
NCBI Protein Information
carbohydrate sulfotransferase 8
UniProt Protein Name
Carbohydrate sulfotransferase 8
UniProt Gene Name
CHST8
UniProt Synonym Gene Names
GalNAc-4-ST1; GalNAc4ST-1
UniProt Entry Name
CHST8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the sulfotransferase 2 family. It is predominantly expressed in the pituitary gland, and is localized to the golgi membrane. This protein catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. It is responsible for sulfation of GalNAc on luteinizing hormone (LH), which is required for production of the sex hormones. Mice lacking this enzyme, exhibit increased levels of circulating LH, and precocious sexual maturation of both male and female mice. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

CHST8: Catalyzes the transfer of sulfate to position 4 of non- reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Required for biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of their carbohydrate structures. Only active against terminal GalNAcbeta1,GalNAcbeta. Not active toward chondroitin. CHST8 mutations may be a cause of generalized non- inflammatory peeling skin syndrome type A (PubMed:22289416). Peeling skin syndrome (PSS) is a genodermatosis characterized by continuous shedding of the outer layers of the epidermis. Two main PSS subtypes have been suggested. Patients with non-inflammatory PSS (type A) manifest white scaling, with painless and easy removal of the skin, irritation when in contact with water, dust and sand, and no history of erythema, pruritis or atopy. Inflammatory PSS (type B) is associated with generalized erythema, pruritus and atopy. It is an ichthyosiform erythroderma characterized by lifelong patchy peeling of the entire skin with onset at birth or shortly after. Several patients have been reported with high IgE levels. Belongs to the sulfotransferase 2 family.

Protein type: Transferase; EC 2.8.2.-; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: N-acetylgalactosamine 4-O-sulfotransferase activity

Biological Process: sulfur metabolic process; central nervous system development; proteoglycan biosynthetic process; hormone biosynthetic process; carbohydrate biosynthetic process

Disease: Peeling Skin Syndrome 3

Research Articles on CHST8

Similar Products

Product Notes

The CHST8 chst8 (Catalog #AAA3219688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHST8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHST8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHST8 chst8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APQQVPGIKF NIRPRQPHHD LPPGGSQDGD LKEPTERVTR DLSSGAPRGR. It is sometimes possible for the material contained within the vial of "CHST8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.