Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHST13 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Cow, Human CHST13 Polyclonal Antibody | anti-CHST13 antibody

CHST13 antibody - N-terminal region

Gene Names
CHST13; C4ST3
Reactivity
Cow, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHST13; Polyclonal Antibody; CHST13 antibody - N-terminal region; anti-CHST13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR
Sequence Length
341
Applicable Applications for anti-CHST13 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHST13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHST13 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CHST13 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-CHST13 antibody
This is a rabbit polyclonal antibody against CHST13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. It transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]).[supplied by OMIM].C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]).[supplied by OMIM].
Product Categories/Family for anti-CHST13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
carbohydrate sulfotransferase 13
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 13
NCBI Official Symbol
CHST13
NCBI Official Synonym Symbols
C4ST3
NCBI Protein Information
carbohydrate sulfotransferase 13
UniProt Protein Name
Carbohydrate sulfotransferase 13
UniProt Gene Name
CHST13
UniProt Synonym Gene Names
C4ST-3; C4ST3
UniProt Entry Name
CHSTD_HUMAN

NCBI Description

The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011]

Uniprot Description

CHST13: Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. No activity toward dermatan. Belongs to the sulfotransferase 2 family.

Protein type: Transferase; Membrane protein, integral; EC 2.8.2.5; Glycan Metabolism - chondroitin sulfate biosynthesis; Energy Metabolism - sulfur

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: N-acetylgalactosamine 4-O-sulfotransferase activity; chondroitin 4-sulfotransferase activity

Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis; carbohydrate biosynthetic process

Research Articles on CHST13

Similar Products

Product Notes

The CHST13 chst13 (Catalog #AAA3209315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHST13 antibody - N-terminal region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHST13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHST13 chst13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALGSSWLGGE KRSPLQKLYD LDQDPRSTLA KVHRQRRDLL NSACSRHSRR. It is sometimes possible for the material contained within the vial of "CHST13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.