Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRND AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit CHRND Polyclonal Antibody | anti-CHRND antibody

CHRND antibody - N-terminal region

Gene Names
CHRND; ACHRD; CMS2A; CMS3A; CMS3B; CMS3C; FCCMS; SCCMS
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CHRND; Polyclonal Antibody; CHRND antibody - N-terminal region; anti-CHRND antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
Sequence Length
517
Applicable Applications for anti-CHRND antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Pig: 100%; Rabbit: 86%; Rat: 85%; Zebrafish: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRND
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRND AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CHRND AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-CHRND antibody
This is a rabbit polyclonal antibody against CHRND. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Product Categories/Family for anti-CHRND antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
acetylcholine receptor subunit delta isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic delta subunit
NCBI Official Symbol
CHRND
NCBI Official Synonym Symbols
ACHRD; CMS2A; CMS3A; CMS3B; CMS3C; FCCMS; SCCMS
NCBI Protein Information
acetylcholine receptor subunit delta
UniProt Protein Name
Acetylcholine receptor subunit delta
Protein Family
UniProt Gene Name
CHRND
UniProt Synonym Gene Names
ACHRD
UniProt Entry Name
ACHD_HUMAN

NCBI Description

The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in this gene are a cause of multiple pterygium syndrome lethal type (MUPSL), congenital myasthenic syndrome slow-channel type (SCCMS), and congenital myasthenic syndrome fast-channel type (FCCMS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Uniprot Description

Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Subunit structure: Pentamer of two alpha chains, and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) chains.

Subcellular location: Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Involvement in disease: Multiple pterygium syndrome, lethal type (LMPS) [MIM:253290]: Multiple pterygia are found infrequently in children with arthrogryposis and in fetuses with fetal akinesia syndrome. In lethal multiple pterygium syndrome there is intrauterine growth retardation, multiple pterygia, and flexion contractures causing severe arthrogryposis and fetal akinesia. Subcutaneous edema can be severe, causing fetal hydrops with cystic hygroma and lung hypoplasia. Oligohydramnios and facial anomalies are frequent.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11Myasthenic syndrome, congenital, slow-channel (SCCMS) [MIM:601462]: A common congenital myasthenic syndrome. Congenital myasthenic syndromes are characterized by muscle weakness affecting the axial and limb muscles (with hypotonia in early-onset forms), the ocular muscles (leading to ptosis and ophthalmoplegia), and the facial and bulbar musculature (affecting sucking and swallowing, and leading to dysphonia). The symptoms fluctuate and worsen with physical effort. Congenital myasthenic syndrome slow-channel type is caused by kinetic abnormalities of the AChR, resulting in prolonged endplate currents and prolonged AChR channel opening episodes.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6 Ref.7Myasthenic syndrome, congenital, fast-channel (FCCMS) [MIM:608930]: A congenital myasthenic syndrome characterized by kinetic abnormalities of the AChR. Due in most cases to mutations that decrease activity of the AChR by slowing the rate of opening of the receptor channel, speeding the rate of closure of the channel, or decreasing the number of openings of the channel during ACh occupancy. The result is failure to achieve threshold depolarization of the endplate and consequent failure to fire an action potential.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.8 Ref.9

Sequence similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily. [View classification]

Research Articles on CHRND

Similar Products

Product Notes

The CHRND chrnd (Catalog #AAA3224479) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRND antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHRND can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRND chrnd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTLGLLAALA VCGSWGLNEE ERLIRHLFQE KGYNKELRPV AHKEESVDVA. It is sometimes possible for the material contained within the vial of "CHRND, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.