Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACH10 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Rabbit CHRNA10 Polyclonal Antibody | anti-CHRNA10 antibody

CHRNA10 Antibody - N-terminal region

Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHRNA10; Polyclonal Antibody; CHRNA10 Antibody - N-terminal region; anti-CHRNA10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQT
Sequence Length
450
Applicable Applications for anti-CHRNA10 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
Immunogen
The immunogen for Anti-CHRNA10 antibody is: synthetic peptide directed towards the N-terminal region of Human ACH10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACH10 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-ACH10 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)
Related Product Information for anti-CHRNA10 antibody
This is a rabbit polyclonal antibody against ACH10. It was validated on Western Blot
Product Categories/Family for anti-CHRNA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-10 isoform a
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 10 subunit
NCBI Official Symbol
CHRNA10
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-10
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-10
UniProt Gene Name
CHRNA10
UniProt Synonym Gene Names
NACHRA10; NACHR alpha-10
UniProt Entry Name
ACH10_HUMAN

Uniprot Description

nAChRA10: Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 10/CHRNA10 sub-subfamily.

Protein type: Membrane protein, multi-pass; Channel, cation; Membrane protein, integral; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; membrane; axon; perikaryon; cell junction

Molecular Function: calcium channel activity; nicotinic acetylcholine-activated cation-selective channel activity; receptor binding

Biological Process: elevation of cytosolic calcium ion concentration; inner ear morphogenesis; detection of mechanical stimulus involved in sensory perception of sound; regulation of cell proliferation; synaptic transmission, cholinergic

Research Articles on CHRNA10

Similar Products

Product Notes

The CHRNA10 chrna10 (Catalog #AAA3202521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA10 Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNA10 chrna10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHHLSLGLLL LFLLPAECLG AEGRLALKLF RDLFANYTSA LRPVADTDQT. It is sometimes possible for the material contained within the vial of "CHRNA10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.