Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)

Rabbit CHRM1 Polyclonal Antibody | anti-CHRM1 antibody

CHRM1 Antibody - C-terminal region

Gene Names
CHRM1; M1; HM1; M1R
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRM1; Polyclonal Antibody; CHRM1 Antibody - C-terminal region; anti-CHRM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI
Sequence Length
460
Applicable Applications for anti-CHRM1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHRM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)

Western Blot (WB) (WB Suggested Anti-CHRM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)
Related Product Information for anti-CHRM1 antibody
This is a rabbit polyclonal antibody against CHRM1. It was validated on Western Blot

Target Description: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.
Product Categories/Family for anti-CHRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
muscarinic acetylcholine receptor M1
NCBI Official Synonym Full Names
cholinergic receptor muscarinic 1
NCBI Official Symbol
CHRM1
NCBI Official Synonym Symbols
M1; HM1; M1R
NCBI Protein Information
muscarinic acetylcholine receptor M1
UniProt Protein Name
Muscarinic acetylcholine receptor M1
UniProt Gene Name
CHRM1
UniProt Entry Name
ACM1_HUMAN

NCBI Description

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13. [provided by RefSeq, Jul 2008]

Uniprot Description

mAChR m1: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM1 sub-subfamily.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: asymmetric synapse; postsynaptic membrane; membrane; integral to plasma membrane; dendrite; postsynaptic density; plasma membrane; nerve terminal; cell junction

Molecular Function: drug binding; phosphoinositide phospholipase C activity; G-protein coupled acetylcholine receptor activity

Biological Process: nervous system development; acetylcholine receptor signaling, muscarinic pathway; protein modification process; signal transduction; muscarinic acetylcholine receptor, phospholipase C activating pathway; regulation of locomotion; cell proliferation; G-protein coupled receptor protein signaling pathway; positive regulation of cell proliferation; protein kinase C activation; neuromuscular synaptic transmission; positive regulation of ion transport; cognition; saliva secretion

Research Articles on CHRM1

Similar Products

Product Notes

The CHRM1 chrm1 (Catalog #AAA3215052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRM1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRM1 chrm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKRPTKKGRD RAGKGQKPRG KEQLAKRKTF SLVKEKKAAR TLSAILLAFI. It is sometimes possible for the material contained within the vial of "CHRM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.