Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHPFSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CHPF Polyclonal Antibody | anti-CHPF antibody

CHPF Antibody - N-terminal region

Gene Names
CHPF; CSS2; CHSY2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHPF; Polyclonal Antibody; CHPF Antibody - N-terminal region; anti-CHPF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAEREKPGAGEG
Sequence Length
497
Applicable Applications for anti-CHPF antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHPF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHPFSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHPFSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-CHPF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85 kDa
NCBI Official Full Name
chondroitin sulfate synthase 2 isoform 2
NCBI Official Synonym Full Names
chondroitin polymerizing factor
NCBI Official Symbol
CHPF
NCBI Official Synonym Symbols
CSS2; CHSY2
NCBI Protein Information
chondroitin sulfate synthase 2
UniProt Protein Name
Chondroitin sulfate synthase 2
UniProt Gene Name
CHPF
UniProt Synonym Gene Names
CSS2; ChPF
UniProt Entry Name
CHSS2_HUMAN

Uniprot Description

CHPF: a type II transmembrane protein. May act as a specific activating factor for chondroitin synthase in chondroitin biosynthesis and polymerization.

Protein type: Transferase; EC 2.4.1.226; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, integral; EC 2.4.1.175

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: Golgi membrane; mitochondrial matrix; integral to membrane; cytosol

Molecular Function: protein binding; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity; metal ion binding; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity

Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis

Research Articles on CHPF

Similar Products

Product Notes

The CHPF chpf (Catalog #AAA3220716) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHPF Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHPF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHPF chpf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVTWVEEPCG PGPPQPGDSE LPPRGNTNAA RRPNSVQPGA EREKPGAGEG. It is sometimes possible for the material contained within the vial of "CHPF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.