Rabbit CHP1 Polyclonal Antibody | anti-CHP1 antibody

CHP1 Polyclonal Antibody

Cat. Num. AAA9140508

• Gene Names: CHP1; CHP; p22; p24; SPAX9; Sid470p; SLC9A1BP
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: CHP1; Polyclonal Antibody; CHP1 Polyclonal Antibody; CHP; SLC9A1BP; Sid470p; p22; p24; calcineurin B homologous protein 1; anti-CHP1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.26 mg/ml (varies by lot)
• Sequence Length: 195

• Applicable Applications for anti-CHP1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human CHP1 (NP_009167.1).
• Immunogen Sequence: MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
• Positive Samples: LO2, 293T, HeLa, Mouse Brain, Mouse Heart, Mouse Kidney, Rat Brain
• Cellular Location: Cell Membrane, Cytoplasm, Endoplasmic Reticulum, Endoplasmic Reticulum-Golgi Intermediate Compartment, Lipid-Anchor, Membrane, Nucleus, Cytoskeleton
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CHP1 Polyclonal Antibody)

Related Product Information for anti-CHP1 antibody

This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.

NCBI and Uniprot Product Information

• NCBI GI #: 6005731
• NCBI GeneID: 11261
• NCBI Accession #: NP_009167.1
• NCBI GenBank Nucleotide #: NP_009167.1
• UniProt Accession #: Q99653
• Molecular Weight: Calculated: 22kDa; Observed: 20kDa
• NCBI Official Full Name: calcineurin B homologous protein 1
• NCBI Official Synonym Full Names: calcineurin like EF-hand protein 1
• NCBI Official Symbol: CHP1
• NCBI Official Synonym Symbols: CHP; p22; p24; SPAX9; Sid470p; SLC9A1BP
• NCBI Protein Information: calcineurin B homologous protein 1
• UniProt Protein Name: Calcineurin B homologous protein 1
• Protein Family: Calcineurin B homologous protein
• UniProt Gene Name: CHP1
• UniProt Synonym Gene Names: CHP
• UniProt Entry Name: CHP1_HUMAN

NCBI Description

This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]

Uniprot Description

CHP: Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate- phosphorylations in a calcium-dependent manner. Belongs to the calcineurin regulatory subunit family. CHP subfamily.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 15q13.3

Cellular Component: Golgi membrane; microtubule cytoskeleton; transport vesicle; focal adhesion; endoplasmic reticulum; cytoplasm; ER-Golgi intermediate compartment; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; potassium channel regulator activity; protein kinase inhibitor activity; transporter activity; microtubule binding; calcium ion binding; kinase binding; calcium-dependent protein binding

Biological Process: glycosaminoglycan metabolic process; pathogenesis; negative regulation of protein import into nucleus; cytoplasmic microtubule organization and biogenesis; hyaluronan catabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of protein amino acid glycosylation; small GTPase mediated signal transduction; negative regulation of protein amino acid autophosphorylation; protein export from nucleus; membrane docking; potassium ion transport; protein stabilization; transcytosis; protein oligomerization; calcium ion-dependent exocytosis; positive regulation of protein transport; inhibition of NF-kappaB transcription factor; carbohydrate metabolic process; regulation of intracellular pH; negative regulation of protein kinase activity; negative regulation of protein ubiquitination; positive regulation of sodium:hydrogen antiporter activity; hyaluronan metabolic process; microtubule bundle formation