Rabbit anti-Human, Mouse CHI3L1 / YKL-40 Polyclonal Antibody | anti-CHI3L1 antibody

Anti-CHI3L1 / YKL-40 Antibody IHC-plus

Cat. Num. AAA249889

• Gene Names: CHI3L1; GP39; ASRT7; GP-39; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39
• Reactivity: Human, Mouse
• Applications: Immunohistochemistry, Immunohistochemistry, Western Blot
• Purity: Affinity purified
• Synonyms: CHI3L1 / YKL-40; Polyclonal Antibody; Anti-CHI3L1 / YKL-40 Antibody IHC-plus; CHI3L1 | 39 kDa synovial protein | ASRT7 | Cartilage glycoprotein 39 | CGP-39 | Chitinase-3-like protein 1 | gp39 | HCGP-39 | HCGP-3P | GP-39 | HC-gp39 | YKL40 | YYL-40 | YKL-40; anti-CHI3L1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Human CHI3L1 / YKL-40
• Purity/Purification: Affinity purified
• Form/Format: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 3.07 mg/ml (varies by lot)
• Sequence Length: 383

• Applicable Applications for anti-CHI3L1 antibody: Immunohistochemistry (IHC), Immunohistochemistry (IHC-P) Paraffin, Western Blot (WB)
• Application Notes: IHC - Paraffin (1:200); Western blot (1:500 - 1:2000)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human CHI3L1 (NP_001267.2). YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTF; IKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHH; SPLFRGQEDASPDRFSNTDYA
• Disclaimer: Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
• Recommended Immunohistochemistry Protocol: The following protocol is a recommendation only, and MyBioSource, Inc. makes no guarantee of the results:; ; Tissue Preparation: ; Formalin fixation and embedding in paraffin wax. ; ; Tissue Sectioning: ; Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C. ; ; Deparaffinization: ; Wash dry slides in 3 changes of xylene - 5 minutes each @ RT; ; Rehydration: ; Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT; Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT; Wash slides in 1 change of 80% alcohol - 3 minutes @ RT; Rinse slides in gentle running distilled water - 5 minutes @ RT; ; Antigen retrieval: ; Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes; Remove from heat and let stand at room temperature in buffer - 20 minutes; Rinse in 1X TBS with Tween (TBST) -1 minute @ RT; ; Immunostaining: ; (Do not allow tissues to dry at any time during the staining procedure) ; Apply a universal protein block - 20 minutes @ RT; Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT; Rinse slides in 1 X TBST - 1 minute @ RT; Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase streptavidin - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT; Wash slides in distilled water - 1 minute @ RT; ; Dehydrate: ; (This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB) ; Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT; Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT; Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT; Wash slides in 3 changes of xylene - 1 minute each @ RT; Apply coverslip
• Preparation and Storage: Store at -20°C. Avoid freeze-thaw cycles.

Immunohistochemistry - Paraffin (IHC)

(Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE))

Western Blot (WB)

(Western blot analysis of extracts of THP1 cells, using CHI3L1 antibody.)

Related Product Information for anti-CHI3L1 antibody

CHI3L1 Antibody, 39 kDa synovial protein Antibody, ASRT7 Antibody, Cartilage glycoprotein 39 Antibody, CGP-39 Antibody, Chitinase-3-like protein 1 Antibody, gp39 Antibody, HCGP-39 Antibody, HCGP-3P Antibody, GP-39 Antibody, HC-gp39 Antibody, YKL40 Antibody, YYL-40 Antibody, YKL-40 Antibody Description: Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation.

NCBI and Uniprot Product Information

• NCBI GI #: 144226251
• NCBI GeneID: 1116
• NCBI Accession #: NP_001267.2
• NCBI GenBank Nucleotide #: NM_001276.2
• UniProt Accession #: P36222; P30923; Q8IVA4; Q96HI7; B2R7B0
• Molecular Weight: Predicted MW: 42kDa; Observed MW by Western blot was 43kDa.
• NCBI Official Full Name: chitinase-3-like protein 1
• NCBI Official Synonym Full Names: chitinase 3 like 1
• NCBI Official Symbol: CHI3L1
• NCBI Official Synonym Symbols: GP39; ASRT7; GP-39; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39
• NCBI Protein Information: chitinase-3-like protein 1
• UniProt Protein Name: Chitinase-3-like protein 1
• Protein Family: Chitinase-3-like protein
• UniProt Gene Name: CHI3L1
• UniProt Synonym Gene Names: CGP-39; GP-39; hCGP-39
• UniProt Entry Name: CH3L1_HUMAN

NCBI Description

Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. [provided by RefSeq, Sep 2009]

Uniprot Description

CHI3L1: Carbohydrate-binding lectin with a preference for chitin. May play a role in defense against pathogens, or in tissue remodeling. May play an important role in the capacity of cells to respond to and cope with changes in their environment. A genetic variation in CHI3L1 is associated with susceptibility to asthma-related traits type 7 (ASRT7). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing and dyspnea, bronchial hyperresponsiveness (BHR) as assessed by methacholine challenge test, serum IgE levels, atopy, and atopic dermatitis. Belongs to the glycosyl hydrolase 18 family.

Protein type: Secreted, signal peptide; Cell adhesion; Secreted

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; endoplasmic reticulum; extracellular space; perinuclear region of cytoplasm; proteinaceous extracellular matrix

Molecular Function: carbohydrate binding; chitin binding; chitinase activity; extracellular matrix structural constituent

Biological Process: activation of NF-kappaB-inducing kinase; apoptosis; carbohydrate metabolic process; cartilage development; chitin catabolic process; inflammatory response; lung development; positive regulation of angiogenesis; positive regulation of protein kinase B signaling cascade; response to mechanical stimulus

Disease: Asthma-related Traits, Susceptibility To, 7; Schizophrenia