Western Blot (WB)
(Host: RabbitTarget Name: CFPSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse CFP Polyclonal Antibody | anti-CFP antibody
CFP Antibody - C-terminal region
Gene Names
Cfp; Pfc; BCFG
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CFP; Polyclonal Antibody; CFP Antibody - C-terminal region; anti-CFP antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WSLCTPPCSPNATRVRQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGTPRP
Sequence Length
464
Applicable Applications for anti-CFP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse CFP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CFPSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CFPSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CFP antibody
A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes.
Product Categories/Family for anti-CFP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
properdin
NCBI Official Synonym Full Names
complement factor properdin
NCBI Official Symbol
Cfp
NCBI Official Synonym Symbols
Pfc; BCFG
NCBI Protein Information
properdin
UniProt Protein Name
Properdin
Protein Family
UniProt Gene Name
Cfp
UniProt Synonym Gene Names
Pfc
UniProt Entry Name
PROP_MOUSE
Uniprot Description
CFP: A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Defects in CFP are the cause of properdin deficiency (PFD). PFD results in higher susceptibility to bacterial infections; especially to meningococcal infections. Three phenotypes have been reported: complete deficiency (type I), incomplete deficiency (type II), and dysfunction of properdin (type III).
Protein type: Secreted; Secreted, signal peptide
Cellular Component: extracellular matrix; extracellular region
Biological Process: immune system process; complement activation, alternative pathway; innate immune response
Research Articles on CFP
Similar Products
Product Notes
The CFP cfp (Catalog #AAA3223529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CFP Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CFP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CFP cfp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WSLCTPPCSP NATRVRQRLC TPLLPKYPPT VSMVEGQGEK NVTFWGTPRP. It is sometimes possible for the material contained within the vial of "CFP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
