Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human MuscleCETP antibody - middle region validated by WB using Human Muscle lysate at 1:1000.)

Rabbit anti-Human CETP Polyclonal Antibody | anti-CETP antibody

CETP antibody - middle region

Gene Names
CETP; BPIFF; HDLCQ10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CETP; Polyclonal Antibody; CETP antibody - middle region; anti-CETP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV
Sequence Length
493
Applicable Applications for anti-CETP antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CETP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human MuscleCETP antibody - middle region validated by WB using Human Muscle lysate at 1:1000.)

Western Blot (WB) (Sample Type: Human MuscleCETP antibody - middle region validated by WB using Human Muscle lysate at 1:1000.)
Related Product Information for anti-CETP antibody
This is a rabbit polyclonal antibody against CETP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
cholesteryl ester transfer protein isoform 1
NCBI Official Synonym Full Names
cholesteryl ester transfer protein
NCBI Official Symbol
CETP
NCBI Official Synonym Symbols
BPIFF; HDLCQ10
NCBI Protein Information
cholesteryl ester transfer protein
UniProt Protein Name
Cholesteryl ester transfer protein
UniProt Gene Name
CETP
UniProt Entry Name
CETP_HUMAN

NCBI Description

The protein encoded by this gene is found in plasma, where it is involved in the transfer of cholesteryl ester from high density lipoprotein (HDL) to other lipoproteins. Defects in this gene are a cause of hyperalphalipoproteinemia 1 (HALP1). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]

Uniprot Description

CETP: Involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are the cause of hyperalphalipoproteinemia type 1 (HALP1). Affected individuals show high levels of alpha-lipoprotein (high density lipoprotein/HDL). Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid-binding; Vesicle; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: extracellular space; extracellular region; vesicle

Molecular Function: lipid transporter activity; phospholipid transporter activity; cholesterol transporter activity; cholesterol binding; phosphatidylcholine binding; lipid binding; triglyceride binding

Biological Process: cholesterol metabolic process; receptor-mediated endocytosis; cholesterol transport; lipid homeostasis; lipoprotein metabolic process; lipid transport; phosphatidylcholine metabolic process; cholesterol homeostasis; reverse cholesterol transport; triacylglycerol metabolic process; phospholipid transport; triacylglycerol transport; transmembrane transport; phospholipid homeostasis

Disease: Hyperalphalipoproteinemia 1

Research Articles on CETP

Similar Products

Product Notes

The CETP cetp (Catalog #AAA3210416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CETP antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CETP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CETP cetp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKLFLSLLDF QITPKTVSNL TESSSESVQS FLQSMITAVG IPEVMSRLEV. It is sometimes possible for the material contained within the vial of "CETP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.