Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CETN2 expression in transfected 293T cell line by CETN2 polyclonal antibody. Lane 1: CETN2 transfected lysate (18.92kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CETN2 Polyclonal Antibody | anti-CETN2 antibody

CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2)

Gene Names
CETN2; CALT; CEN2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CETN2; Polyclonal Antibody; CETN2 (Centrin-2; Caltractin Isoform 1; CALT; CEN2); Anti -CETN2 (Centrin-2; anti-CETN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CETN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Applicable Applications for anti-CETN2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CETN2, aa1-172 (NP_004335.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CETN2 expression in transfected 293T cell line by CETN2 polyclonal antibody. Lane 1: CETN2 transfected lysate (18.92kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CETN2 expression in transfected 293T cell line by CETN2 polyclonal antibody. Lane 1: CETN2 transfected lysate (18.92kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CETN2 antibody
Plays a fundamental role in microtubule-organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CEP110.
Product Categories/Family for anti-CETN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,738 Da
NCBI Official Full Name
centrin-2
NCBI Official Synonym Full Names
centrin, EF-hand protein, 2
NCBI Official Symbol
CETN2
NCBI Official Synonym Symbols
CALT; CEN2
NCBI Protein Information
centrin-2; caltractin (20kD calcium-binding protein)
UniProt Protein Name
Centrin-2
Protein Family
UniProt Gene Name
CETN2
UniProt Synonym Gene Names
CALT; CEN2
UniProt Entry Name
CETN2_HUMAN

NCBI Description

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008]

Uniprot Description

CETN2: a calcium-binding proteins and is a structural component of the centrosome. Contains 4 EF-hand calcium-binding domains. Highly conserved from algae to humans. Its association with the centrosome suggests that it plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Protein type: DNA repair, damage; Cell cycle regulation; Calcium-binding

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: centriole; centrosome; intracellular; cytosol; photoreceptor connecting cilium

Molecular Function: protein binding; microtubule binding; G-protein beta/gamma-subunit binding; calcium ion binding; heterotrimeric G-protein binding

Biological Process: mitosis; cell division; nucleotide-excision repair; organelle organization and biogenesis; centriole replication; spermatogenesis; mitotic cell cycle; G2/M transition of mitotic cell cycle; regulation of cytokinesis

Research Articles on CETN2

Similar Products

Product Notes

The CETN2 cetn2 (Catalog #AAA6011155) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CETN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CETN2 cetn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASNFKKANM ASSSQRKRMS PKPELTEEQK QEIREAFDLF DADGTGTIDV KELKVAMRAL GFEPKKEEIK KMISEIDKEG TGKMNFGDFL TVMTQKMSEK DTKEEILKAF KLFDDDETGK ISFKNLKRVA KELGENLTDE ELQEMIDEAD RDGDGEVSEQ EFLRIMKKTS LY. It is sometimes possible for the material contained within the vial of "CETN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.