Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CERS5 Polyclonal Antibody)

Rabbit anti-Human CERS5 Polyclonal Antibody | anti-CERS5 antibody

CERS5 Polyclonal Antibody

Gene Names
CERS5; Trh4; LASS5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CERS5; Polyclonal Antibody; CERS5 Polyclonal Antibody; LASS5; Trh4; ceramide synthase 5; anti-CERS5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.42 mg/ml (varies by lot)
Sequence Length
392
Applicable Applications for anti-CERS5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1).
Immunogen Sequence
MMKPRPKRFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CERS5 Polyclonal Antibody)

Western Blot (WB) (Western blot-CERS5 Polyclonal Antibody)
Related Product Information for anti-CERS5 antibody
This gene encodes a protein that belongs to the TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins. The encoded protein functions in the synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ceramide synthase 5 isoform 1
NCBI Official Synonym Full Names
ceramide synthase 5
NCBI Official Symbol
CERS5
NCBI Official Synonym Symbols
Trh4; LASS5
NCBI Protein Information
ceramide synthase 5
UniProt Protein Name
Ceramide synthase 5
Protein Family
UniProt Gene Name
CERS5
UniProt Synonym Gene Names
LASS5; CerS5
UniProt Entry Name
CERS5_HUMAN

NCBI Description

This gene encodes a protein that belongs to the TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins. The encoded protein functions in the synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

LASS5: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked palmitoyl- (C16) ceramide) in a fumonisin B1-independent manner.

Protein type: EC 2.3.1.24; DNA-binding; Membrane protein, multi-pass; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.12

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; integral to membrane

Molecular Function: DNA binding; sphingosine N-acyltransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; ceramide biosynthetic process

Research Articles on CERS5

Similar Products

Product Notes

The CERS5 cers5 (Catalog #AAA9141073) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CERS5 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CERS5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CERS5 cers5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CERS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.