Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CEP57 expression in transfected 293T cell line by CEP57 polyclonal antibody. Lane 1: CEP57 transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CEP57 Polyclonal Antibody | anti-CEP57 antibody

CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific Protein 57, Translokin)

Gene Names
CEP57; MVA2; PIG8; TSP57
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CEP57; Polyclonal Antibody; CEP57 (KIAA0092; TSP57; Centrosomal Protein of 57kD; FGF2-interacting Protein; Testis-specific Protein 57; Translokin); Anti -CEP57 (KIAA0092; anti-CEP57 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CEP57.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY
Applicable Applications for anti-CEP57 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CEP57, aa1-500 (NP_055494.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CEP57 expression in transfected 293T cell line by CEP57 polyclonal antibody. Lane 1: CEP57 transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CEP57 expression in transfected 293T cell line by CEP57 polyclonal antibody. Lane 1: CEP57 transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CEP57 antibody
Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM].
Product Categories/Family for anti-CEP57 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,089 Da
NCBI Official Full Name
centrosomal protein of 57 kDa isoform c
NCBI Official Synonym Full Names
centrosomal protein 57kDa
NCBI Official Symbol
CEP57
NCBI Official Synonym Symbols
MVA2; PIG8; TSP57
NCBI Protein Information
centrosomal protein of 57 kDa; translokin; FGF2-interacting protein; testis-specific protein 57; proliferation-inducing protein 8
UniProt Protein Name
Centrosomal protein of 57 kDa
Protein Family
UniProt Gene Name
CEP57
UniProt Synonym Gene Names
KIAA0092; TSP57; Cep57
UniProt Entry Name
CEP57_HUMAN

NCBI Description

This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerization, and the C-terminal half is required for nucleating, bundling and anchoring microtubules to the centrosomes. This protein specifically interacts with fibroblast growth factor 2 (FGF2), sorting nexin 6, Ran-binding protein M and the kinesins KIF3A and KIF3B, and thus mediates the nuclear translocation and mitogenic activity of the FGF2. It also interacts with cyclin D1 and controls nucleocytoplasmic distribution of the cyclin D1 in quiescent cells. This protein is crucial for maintaining correct chromosomal number during cell division. Mutations in this gene cause mosaic variegated aneuploidy syndrome, a rare autosomal recessive disorder. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Uniprot Description

Function: Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but that of FGF1. Ref.10

Subunit structure: Homodimer and homooligomer. Interacts with microtubules. Interacts with FGF2 and RAP80. Does not interact with FGF1 or FGF2 isoform 24 kDa. Ref.1

Subcellular location: Nucleus

By similarity. Cytoplasm. Cytoplasm › cytoskeleton › microtubule organizing center › centrosome Ref.1 Ref.7.

Tissue specificity: Ubiquitous. Ref.1

Domain: The C-terminal region mediates the interaction with microtubules and is able to nucleate and bundles microtubules in vitro

By similarity.The centrosome localization domain (CLD) region mediates the localization to centrosomes and homooligomerization

By similarity.

Involvement in disease: Mosaic variegated aneuploidy syndrome 2 (MVA2) [MIM:614114]: A severe developmental disorder characterized by mosaic aneuploidies, predominantly trisomies and monosomies, involving multiple different chromosomes and tissues. Affected individuals typically present with severe intrauterine growth retardation and microcephaly. Eye anomalies, mild dysmorphism, variable developmental delay, and a broad spectrum of additional congenital abnormalities and medical conditions may also occur. The risk of malignancy is high, with rhabdomyosarcoma, Wilms tumor and leukemia reported in several cases.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.8

Sequence similarities: Belongs to the translokin family.

Sequence caution: The sequence AAH29385.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.The sequence BAA07654.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on CEP57

Similar Products

Product Notes

The CEP57 cep57 (Catalog #AAA646373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEP57 (KIAA0092, TSP57, Centrosomal Protein of 57kD, FGF2-interacting Protein, Testis-specific Protein 57, Translokin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEP57 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CEP57 cep57 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAASVSAAS GSHLSNSFAE PSRSNGSMVR HSSSPYVVYP SDKPFLNSDL RRSPSKPTLA YPESNSRAIF SALKNLQDKI RRLELERIQA EESVKTLSRE TIEYKKVLDE QIQERENSKN EESKHNQELT SQLLAAENKC NLLEKQLEYM RNMIKHAEME RTSVLEKQVS LERERQHDQT HVQSQLEKLD LLEQEYNKLT TMQALAEKKM QELEAKLHEE EQERKRMQAK AAELQTGLET NRLIFEDKAT PCVPNARRIK KKKSKPPEKK SSRNYFGAQP HYRLCLGDMP FVAGKSTSPS HAVVANVQLV LHLMKQHSKA LCNDRVINSI PLAKQVSSRG GKSKKLSVTP PSSNGINEEL SEVLQTLQDE FGQMSFDHQQ LAKLIQESPT VELKDKLECE LEALVGRMEA KANQITKVRK YQAQLEKQKL EKQKKELKAT KKTLDEERNS SSRSGITGTT NKKDFMKLRP GEKRRKNLQL LKDMQSIQNS LQSSSLCWDY. It is sometimes possible for the material contained within the vial of "CEP57, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.