Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23575_WB6.jpg WB (Western Blot) (WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit anti-Human CENPQ Polyclonal Antibody | anti-CENPQ antibody

CENPQ antibody - N-terminal region

Gene Names
CENPQ; CENP-Q; C6orf139
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CENPQ, Antibody; CENPQ antibody - N-terminal region; anti-CENPQ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL
Sequence Length
268
Applicable Applications for anti-CENPQ antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA23575_WB6.jpg WB (Western Blot) (WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: CENPQSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23575_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: CENPQSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CENPQSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23575_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: CENPQSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CENPQSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23575_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: CENPQSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CENPQSample Type: Human 721_BAntibody Dilution: 1.0ug/mlCENPQ is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23575_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: CENPQSample Type: Human 721_BAntibody Dilution: 1.0ug/mlCENPQ is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: CENPQSample Type: Human 293TAntibody Dilution: 1.0ug/mlCENPQ is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA23575_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: CENPQSample Type: Human 293TAntibody Dilution: 1.0ug/mlCENPQ is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-CENPQ antibody
This is a rabbit polyclonal antibody against CENPQ. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).
Product Categories/Family for anti-CENPQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
centromere protein Q
NCBI Official Synonym Full Names
centromere protein Q
NCBI Official Symbol
CENPQ
NCBI Official Synonym Symbols
CENP-Q; C6orf139
NCBI Protein Information
centromere protein Q
UniProt Protein Name
Centromere protein Q
UniProt Gene Name
CENPQ
UniProt Synonym Gene Names
C6orf139; CENP-Q
UniProt Entry Name
CENPQ_HUMAN

Similar Products

Product Notes

The CENPQ cenpq (Catalog #AAA23575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPQ antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CENPQ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CENPQ cenpq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRNTVKKNKN HLKDLSSEGQ TKHTNLKHGK TAASKRKTWQ PLSKSTRDHL. It is sometimes possible for the material contained within the vial of "CENPQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.