Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CENPASample Type: 721_BAntibody Dilution: 1.0ug/mlCENPA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit CENPA Polyclonal Antibody | anti-CENPA antibody

CENPA antibody - middle region

Gene Names
CENPA; CenH3; CENP-A
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CENPA; Polyclonal Antibody; CENPA antibody - middle region; anti-CENPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Sequence Length
140
Applicable Applications for anti-CENPA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CENPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CENPASample Type: 721_BAntibody Dilution: 1.0ug/mlCENPA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: CENPASample Type: 721_BAntibody Dilution: 1.0ug/mlCENPA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB)

(WB Suggested Anti-CENPA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate.CENPA is strongly supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-CENPA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate.CENPA is strongly supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-CENPA antibody
This is a rabbit polyclonal antibody against CENPA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-CENPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
histone H3-like centromeric protein A isoform a
NCBI Official Synonym Full Names
centromere protein A
NCBI Official Symbol
CENPA
NCBI Official Synonym Symbols
CenH3; CENP-A
NCBI Protein Information
histone H3-like centromeric protein A
UniProt Protein Name
Histone H3-like centromeric protein A
UniProt Gene Name
CENPA
UniProt Synonym Gene Names
CENP-A
UniProt Entry Name
CENPA_HUMAN

NCBI Description

Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]

Uniprot Description

CENPA: a basic nuclear protein of the histone H3 family. May act as a core histone necessary for the assembly of centromeres. Contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: nucleoplasm; inner kinetochore of condensed chromosome; nucleosome; cytosol; nucleus; chromosome, pericentric region; condensed nuclear chromosome, pericentric region

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; chromatin binding

Biological Process: nucleosome assembly; kinetochore assembly; DNA replication-independent nucleosome assembly at centromere; viral reproduction; establishment of mitotic spindle orientation; mitotic cell cycle

Research Articles on CENPA

Similar Products

Product Notes

The CENPA cenpa (Catalog #AAA3208015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPA antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CENPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CENPA cenpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALQEAAEAFL VHLFEDAYLL TLHAGRVTLF PKDVQLARRI RGLEEGLG. It is sometimes possible for the material contained within the vial of "CENPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.