Western Blot (WB)
(Western blot analysis of extracts of Mouse lung, using CELA2A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Mouse, Rat CELA2A Polyclonal Antibody | anti-CELA2A antibody
CELA2A Rabbit pAb
Gene Names
CELA2A; PE-1; ELA2A
Reactivity
Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
CELA2A; Polyclonal Antibody; CELA2A Rabbit pAb; ELA2A; PE-1; anti-CELA2A antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP
Applicable Applications for anti-CELA2A antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 80-150 of human CELA2A (NP_254275.1).
Positive Samples
Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Mouse lung, using CELA2A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of Mouse lung, using CELA2A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Immunofluorescence (IF)
(Immunofluorescence analysis of mouse pancreas using CELA2A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of mouse pancreas using CELA2A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CELA2A antibody
Background: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
28,888 Da
NCBI Official Full Name
elastase 2A
NCBI Official Synonym Full Names
chymotrypsin-like elastase family, member 2A
NCBI Official Symbol
CELA2A
NCBI Official Synonym Symbols
PE-1; ELA2A
NCBI Protein Information
chymotrypsin-like elastase family member 2A; elastase 2A; elastase-2A; pancreatic elastase 2; pancreatic elastase IIA
UniProt Protein Name
Chymotrypsin-like elastase family member 2A
Protein Family
UniProt Gene Name
CELA2A
UniProt Synonym Gene Names
ELA2A
UniProt Entry Name
CEL2A_HUMAN
Similar Products
Product Notes
The CELA2A cela2a (Catalog #AAA9142656) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CELA2A Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CELA2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the CELA2A cela2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TYRVGLGRHN LYVAESGSLA VSVSKIVVHK DWNSNQISKG NDIALLKLAN PVSLTDKIQL ACLPPAGTIL P. It is sometimes possible for the material contained within the vial of "CELA2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
