Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CEL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)

Rabbit CEL Polyclonal Antibody | anti-CEL antibody

CEL antibody - C - terminal region

Gene Names
CEL; BAL; FAP; BSDL; BSSL; CELL; FAPP; LIPA; CEase; MODY8
Reactivity
Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEL; Polyclonal Antibody; CEL antibody - C - terminal region; anti-CEL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR
Sequence Length
756
Applicable Applications for anti-CEL antibody
Western Blot (WB)
Homology
Horse: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C - terminal region of human CEL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CEL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)

Western Blot (WB) (WB Suggested Anti-CEL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SH-SYSY cell lysate)
Related Product Information for anti-CEL antibody
This is a rabbit polyclonal antibody against CEL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
bile salt-activated lipase
NCBI Official Synonym Full Names
carboxyl ester lipase
NCBI Official Symbol
CEL
NCBI Official Synonym Symbols
BAL; FAP; BSDL; BSSL; CELL; FAPP; LIPA; CEase; MODY8
NCBI Protein Information
bile salt-activated lipase
UniProt Protein Name
Bile salt-activated lipase
Protein Family
UniProt Gene Name
CEL
UniProt Synonym Gene Names
BAL; BAL; BSSL
UniProt Entry Name
CEL_HUMAN

NCBI Description

The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. [provided by RefSeq, Jul 2008]

Uniprot Description

CEL: Catalyzes fat and vitamin absorption. Acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides. Defects in CEL are a cause of maturity-onset diabetes of the young type 8 with exocrine dysfunction (MODY8); also known as diabetes and pancreatic exocrine dysfunction (DPED). MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.3; Secreted; EC 3.1.1.13; Lipase; Secreted, signal peptide; Lipid Metabolism - steroid biosynthesis; Lipid Metabolism - glycerolipid

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: heparin binding; sterol esterase activity; triacylglycerol lipase activity; protein binding; hydrolase activity; acylglycerol lipase activity; catalytic activity

Biological Process: intestinal lipid catabolic process; triacylglycerol metabolic process; cholesterol absorption; lipid metabolic process; fatty acid catabolic process; protein amino acid esterification; pancreatic juice secretion; cholesterol catabolic process; lipid digestion

Disease: Maturity-onset Diabetes Of The Young, Type 8, With Exocrine Dysfunction

Research Articles on CEL

Similar Products

Product Notes

The CEL cel (Catalog #AAA3201756) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEL antibody - C - terminal region reacts with Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CEL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEL cel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTPTGDSETA PVPPTGDSGA PPVPPTGDSE AAPVPPTDDS KEAQMPAVIR. It is sometimes possible for the material contained within the vial of "CEL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.