Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D MaxPab polyclonal antibody.Lane 1: CDKN2D transfected lysate(17.70 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human CDKN2D Polyclonal Antibody | anti-CDKN2D antibody

CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D) (APC)

Gene Names
CDKN2D; p19; INK4D; p19-INK4D
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CDKN2D; Polyclonal Antibody; CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19; inhibits CDK4); INK4D; p19; p19-INK4D) (APC); Cyclin-Dependent Kinase Inhibitor 2D (p19; p19-INK4D; anti-CDKN2D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDKN2D.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CDKN2D antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CDKN2D (NP_001791.1, 1aa-166aa) full-length human protein.
Immunogen Sequence
MLLEEVRAGDRLSGRGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D MaxPab polyclonal antibody.Lane 1: CDKN2D transfected lysate(17.70 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D MaxPab polyclonal antibody.Lane 1: CDKN2D transfected lysate(17.70 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CDKN2D antibody
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq]
Product Categories/Family for anti-CDKN2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,700 Da
NCBI Official Full Name
cyclin-dependent kinase 4 inhibitor D
NCBI Official Synonym Full Names
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
NCBI Official Symbol
CDKN2D
NCBI Official Synonym Symbols
p19; INK4D; p19-INK4D
NCBI Protein Information
cyclin-dependent kinase 4 inhibitor D; CDK inhibitor p19INK4d; inhibitor of cyclin-dependent kinase 4d; cyclin-dependent kinase 4 inhibitor D p19; cell cycle inhibitor, Nur77 associating protein
UniProt Protein Name
Cyclin-dependent kinase 4 inhibitor D
UniProt Gene Name
CDKN2D
UniProt Entry Name
CDN2D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

CDKN2D: Interacts strongly with CDK4 and CDK6 and inhibits them. Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Protein type: Tumor suppressor; Inhibitor; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase binding

Biological Process: response to retinoic acid; negative regulation of caspase activity; negative regulation of cell proliferation; DNA synthesis during DNA repair; response to vitamin D; sensory perception of sound; autophagic cell death; negative regulation of phosphorylation; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; negative regulation of cell growth; cell cycle arrest; G1/S transition of mitotic cell cycle; response to UV

Research Articles on CDKN2D

Similar Products

Product Notes

The CDKN2D cdkn2d (Catalog #AAA6450707) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN2D can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDKN2D cdkn2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDKN2D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.