Rabbit anti-Human CDKN2D Polyclonal Antibody | anti-CDKN2D antibody

CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D) (APC)

Cat. Num. AAA6450707

• Gene Names: CDKN2D; p19; INK4D; p19-INK4D
• Reactivity: Human
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: CDKN2D; Polyclonal Antibody; CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19; inhibits CDK4); INK4D; p19; p19-INK4D) (APC); Cyclin-Dependent Kinase Inhibitor 2D (p19; p19-INK4D; anti-CDKN2D antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CDKN2D.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CDKN2D antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CDKN2D (NP_001791.1, 1aa-166aa) full-length human protein.
• Immunogen Sequence: MLLEEVRAGDRLSGRGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D MaxPab polyclonal antibody.Lane 1: CDKN2D transfected lysate(17.70 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-CDKN2D antibody

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq]

Product Categories/Family for anti-CDKN2D antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4502753
• NCBI GeneID: 1032
• NCBI Accession #: NP_001791.1
• NCBI GenBank Nucleotide #: NM_001800.3
• UniProt Accession #: P55273; Q13102; Q6FGE9
• Molecular Weight: 17,700 Da
• NCBI Official Full Name: cyclin-dependent kinase 4 inhibitor D
• NCBI Official Synonym Full Names: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
• NCBI Official Symbol: CDKN2D
• NCBI Official Synonym Symbols: p19; INK4D; p19-INK4D
• NCBI Protein Information: cyclin-dependent kinase 4 inhibitor D; CDK inhibitor p19INK4d; inhibitor of cyclin-dependent kinase 4d; cyclin-dependent kinase 4 inhibitor D p19; cell cycle inhibitor, Nur77 associating protein
• UniProt Protein Name: Cyclin-dependent kinase 4 inhibitor D
• Protein Family: Cyclin-dependent kinase 4 inhibitor
• UniProt Gene Name: CDKN2D
• UniProt Entry Name: CDN2D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

CDKN2D: Interacts strongly with CDK4 and CDK6 and inhibits them. Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Protein type: Tumor suppressor; Inhibitor; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase binding

Biological Process: response to retinoic acid; negative regulation of caspase activity; negative regulation of cell proliferation; DNA synthesis during DNA repair; response to vitamin D; sensory perception of sound; autophagic cell death; negative regulation of phosphorylation; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; negative regulation of cell growth; cell cycle arrest; G1/S transition of mitotic cell cycle; response to UV