Rabbit CDKN2C Polyclonal Antibody | anti-CDKN2C antibody

CDKN2C Antibody

Cat. Num. AAA3249589

• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: CDKN2C; Polyclonal Antibody; CDKN2C Antibody; Cyclin-dependent kinase 4 inhibitor C; NIF3L1; NAGK; AHCYL1; UBC; TCF12; TCF4; REL; CDK6; CDK4; GOPC; LY96; MAPK10; MAPK8; PPP2CA; ATR; ATM; COPS6; CCDC90B; RBM48; UNC119; DRAP1; GDF9; NHP2L1; TLE1; CDKN2A; TP53; APLP1; LRIF1; QPCTL; p18; INK4C; p18-INK4C; anti-CDKN2C antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
• Sequence: VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

• Applicable Applications for anti-CDKN2C antibody: Immunohistochemistry (IHC)
• Protein Size: 168 amino acids
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CDKN2C antibodyFormalin Fixed Paraffin Embedded Tissue: Human Skeletal MusclePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-CDKN2C antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThymusPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Related Product Information for anti-CDKN2C antibody

Description of Target: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

NCBI and Uniprot Product Information

• NCBI GeneID: 1031
• UniProt Accession #: P42773; NP_001253
• Molecular Weight: 18kDa
• UniProt Protein Name: Cyclin-dependent kinase 4 inhibitor C
• Protein Family: Cyclin-dependent kinase 4 inhibitor
• UniProt Gene Name: CDKN2C
• UniProt Synonym Gene Names: CDKN6
• UniProt Entry Name: CDN2C_HUMAN

Uniprot Description

CDKN2C: Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB. Heterodimer of p18 with CDK6. Highest levels found in skeletal muscle. Also found in pancreas and heart. Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Protein type: Cell cycle regulation; Protein kinase, regulatory subunit; Inhibitor

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase binding

Biological Process: negative regulation of cell proliferation; oligodendrocyte differentiation; negative regulation of phosphorylation; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; negative regulation of cell growth; cell cycle arrest; G1/S transition of mitotic cell cycle