Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CDK7 rabbit polyclonal antibody. Western Blot analysis of CDK7 expression in human pancreas.)

Rabbit anti-Human CDK7 Polyclonal Antibody | anti-CDK7 antibody

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (HRP)

Gene Names
CDK7; CAK1; HCAK; MO15; STK1; CDKN7; p39MO15
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK7; Polyclonal Antibody; CDK7 (Cell Division Protein Kinase 7; CDK-activating Kinase; CAK; TFIIH Basal Transcription Factor Complex Kinase Subunit; 39kD Protein Kinase; P39 Mo15; STK1; CAK1; MO15) (HRP); anti-CDK7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDK7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-CDK7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CDK7, aa1-346 (NP_001790.1).
Immunogen Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CDK7 rabbit polyclonal antibody. Western Blot analysis of CDK7 expression in human pancreas.)

Western Blot (WB) (CDK7 rabbit polyclonal antibody. Western Blot analysis of CDK7 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of CDK7 expression in transfected 293T cell line by CDK7 polyclonal antibody. Lane 1: CDK7 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CDK7 expression in transfected 293T cell line by CDK7 polyclonal antibody. Lane 1: CDK7 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK7 and E2F1 HeLa cells were stained with CDK7 rabbit purified polyclonal 1:1200 and E2F1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK7 and E2F1 HeLa cells were stained with CDK7 rabbit purified polyclonal 1:1200 and E2F1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with CDK7 rabbit purified polyclonal 1:1200 and E2F1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CDK7 and E2F1. Huh7 cells were stained with CDK7 rabbit purified polyclonal 1:1200 and E2F1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CDK7 antibody
CDK7, a CDC2/CDK type protein kinase, is the catalytic component of the Cdk-activating kinase (CAK) which acts as a regulator of cell cycle progression. CDK7 complexes with cyclin H and MAT1 to form CAK, and this multi-subunit protein phosphorylates the cyclin-dependent protein kinases CDC2/CDK1, CDK2, CDK4 and CDK6. CAK also associates with the transcription factor IIH (TFIIH) which functions in transcription initiation and DNA repair. TFIIH has been shown to be regulated by CDK8/cyclin C.
Product Categories/Family for anti-CDK7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,038 Da
NCBI Official Full Name
cyclin-dependent kinase 7
NCBI Official Synonym Full Names
cyclin-dependent kinase 7
NCBI Official Symbol
CDK7
NCBI Official Synonym Symbols
CAK1; HCAK; MO15; STK1; CDKN7; p39MO15
NCBI Protein Information
cyclin-dependent kinase 7; CAK; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kina
UniProt Protein Name
Cyclin-dependent kinase 7
Protein Family
UniProt Gene Name
CDK7
UniProt Synonym Gene Names
CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15
UniProt Entry Name
CDK7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

CDK7: a protein kinase of the CDK family. Forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). Activates the cyclin-associated kinases CDK1, -2, -4 and -6. An essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. Serves as a direct link between the regulation of transcription and the cell cycle. Phosphorylates and activates RNA polymerase II, allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.

Protein type: Cell cycle regulation; Nuclear receptor co-regulator; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.22; Protein kinase, CMGC; EC 2.7.11.23; CMGC group; CDK family; CDK7 subfamily; CDK/CDK7 subfamily

Chromosomal Location of Human Ortholog: 5q12.1

Cellular Component: nucleoplasm; mitochondrion; holo TFIIH complex; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein C-terminus binding; RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; androgen receptor binding; cyclin-dependent protein kinase activity; transcription coactivator activity; ATP binding; protein kinase activity

Biological Process: transcription from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; regulation of gene expression, epigenetic; mRNA capping; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; nucleotide-excision repair, DNA damage removal; G2/M transition of mitotic cell cycle; cell cycle arrest; transcription initiation from RNA polymerase II promoter; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; DNA repair; termination of RNA polymerase I transcription; cell proliferation; nucleotide-excision repair; cell division; RNA elongation from RNA polymerase II promoter; androgen receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; transcription initiation from RNA polymerase I promoter; G1/S transition of mitotic cell cycle

Research Articles on CDK7

Similar Products

Product Notes

The CDK7 cdk7 (Catalog #AAA6373569) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK7 cdk7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.