Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CDK5RAP2 Polyclonal Antibody | anti-CDK5RAP2 antibody

CDK5RAP2 Polyclonal Antibody

Gene Names
CDK5RAP2; C48; MCPH3; Cep215
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CDK5RAP2; Polyclonal Antibody; CDK5RAP2 Polyclonal Antibody; C48; Cep215; MCPH3; anti-CDK5RAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS
Sequence Length
1814
Applicable Applications for anti-CDK5RAP2 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human CDK5RAP2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Golgi apparatus, centrosome, cytoskeleton, microtubule organizing center
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-CDK5RAP2 antibody
This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CDK5RAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
206kDa/210kDa/211kDa/215kDa
NCBI Official Full Name
CDK5 regulatory subunit-associated protein 2 isoform b
NCBI Official Synonym Full Names
CDK5 regulatory subunit associated protein 2
NCBI Official Symbol
CDK5RAP2
NCBI Official Synonym Symbols
C48; MCPH3; Cep215
NCBI Protein Information
CDK5 regulatory subunit-associated protein 2
UniProt Protein Name
CDK5 regulatory subunit-associated protein 2
UniProt Gene Name
CDK5RAP2
UniProt Synonym Gene Names
CEP215; KIAA1633

NCBI Description

This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

Potential regulator of CDK5 activity via its interaction with CDK5R1. Negative regulator of centriole disengagement (licensing) which maintains centriole engagement and cohesion. Involved in regulation of mitotic spindle orientation (). Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Together with MAPRE1, it may promote microtubule polymerization, bundle formation, growth and dynamics at the plus ends. Regulates centrosomal maturation by recruitment of a gamma-tubulin ring complex onto centrosomes (PubMed:26485573).

Research Articles on CDK5RAP2

Similar Products

Product Notes

The CDK5RAP2 cdk5rap2 (Catalog #AAA9135462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5RAP2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5RAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the CDK5RAP2 cdk5rap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQRLLAEMDI QTQEAPSSTS QELGTKGPHP APLSKFVSSV STAKLTLEEA YRRLKLLWRV SLPEDGQCPL HCEQIGEMKA EVTKLHKKLF EQEKKLQNTM KLLQLSKRQE KVIFDQLVVT HKILRKARGN LELRPGGAHP GTCSPSRPGS. It is sometimes possible for the material contained within the vial of "CDK5RAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.