Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse brain, using CDK5R2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Mouse CDK5R2 Polyclonal Antibody | anti-CDK5R2 antibody

CDK5R2 Rabbit pAb

Gene Names
CDK5R2; P39; NCK5AI; p39nck5ai
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
CDK5R2; Polyclonal Antibody; CDK5R2 Rabbit pAb; NCK5AI; P39; p39nck5ai; anti-CDK5R2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLR
Applicable Applications for anti-CDK5R2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human CDK5R2 (NP_003927.1).
Positive Samples
Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse brain, using CDK5R2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse brain, using CDK5R2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CDK5R2 antibody
Background: The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,705 Da
NCBI Official Full Name
cyclin-dependent kinase 5 activator 2
NCBI Official Synonym Full Names
cyclin-dependent kinase 5, regulatory subunit 2 (p39)
NCBI Official Symbol
CDK5R2
NCBI Official Synonym Symbols
P39; NCK5AI; p39nck5ai
NCBI Protein Information
cyclin-dependent kinase 5 activator 2; p39I; CDK5 activator 2; neuronal CDK5 activator isoform; cyclin-dependent kinase 5 regulatory subunit 2; cyclin-dependent kinase 5 activator isoform p39i
UniProt Protein Name
Cyclin-dependent kinase 5 activator 2
UniProt Gene Name
CDK5R2
UniProt Synonym Gene Names
NCK5AI; CDK5 activator 2
UniProt Entry Name
CD5R2_HUMAN

NCBI Description

The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

CDK5R2: Activator of CDK5/TPKII. Heterodimer of a catalytic subunit and a regulatory subunit. Brain and neuron specific. Belongs to the cyclin-dependent kinase 5 activator family.

Protein type: Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cyclin-dependent protein kinase 5 activator complex; cytoplasm; plasma membrane

Molecular Function: cyclin-dependent protein kinase 5 activator activity; lipid binding

Biological Process: superior olivary nucleus maturation; positive regulation of calcium ion-dependent exocytosis; hippocampus development; neuron migration; cerebellum development; regulation of cyclin-dependent protein kinase activity; layer formation in the cerebral cortex

Research Articles on CDK5R2

Similar Products

Product Notes

The CDK5R2 cdk5r2 (Catalog #AAA9142855) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5R2 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CDK5R2 cdk5r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGGSPRRVIV QASTGELLRC LGDFVCRRCY RLKELSPGEL VGWFRGVDRS LLLQGWQDQA FITPANLVFV YLLCRESLRG DELASAAELQ AAFLTCLYLA YSYMGNEISY PLKPFLVEPD KERFWQRCLR LIQRLSPQML R. It is sometimes possible for the material contained within the vial of "CDK5R2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.